TkA05G067490 | RubberDandelionOmics

Gene overview

TkA05G067490

Reference: TK1151 Chr: Chr05 Coordinates: 18014137-18018156 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1930 bp · TkA05G067490|TK1151|cDNA

AAGACAGAAAAATGAATTGAATTTTGATTGTGAAGCATCAAACAACTGGAACCCTTTTTATCTCATTCTGTATATGAAAGACAACAAAAAAGAAGCGATAGAAATTAGAACCCAATAACAAATATATGCTTATCTCTCTCTTTATTTTCTCTCTCTAGAAATTGGTGCCTTTTTTTCATTTCTTCGGAGAAATTGAATCAAAATCATGGGTCTTTGTGCATCAGCTCCAAAATCAAGAACAACCCCAGAAAAGAATCAGT...

CDS

Download CDS FASTA

1572 bp · TkA05G067490|TK1151|CDS

ATGGGTCTTTGTGCATCAGCTCCAAAATCAAGAACAACCCCAGAAAAGAATCAGTTTCAGAACCATCAAAAGAGCAATCTTTTTAGCTATAATCACGCAAACTCACCCTCCTCAAACAGCCCTCAAAAGTTTTCCGGTCAGGTTCCGTCACAAACCACCATAGGAGCTGCTGGTGGTGGTGGCGCTACTCCTTCTTTCTCCGAGTTCTCTTTTGCCGACTTAAAAACTGCTACTAACAACTTCAGTACAGATTTAATCGT...

Protein

Download Protein FASTA

523 aa · TkA05G067490|TK1151|PROTEIN

MGLCASAPKSRTTPEKNQFQNHQKSNLFSYNHANSPSSNSPQKFSGQVPSQTTIGAAGGGGATPSFSEFSFADLKTATNNFSTDLIVSESGEKAPNLVYKGRLKNRRWIAVKKFSKLAWPDPKQFAEEAWGVGKLRHKRLANLIGYCCDGEERLLVAEYMPNDTLAKHLFHWENQTIEWAMRIRVAQYISDALNYCSTEGREVYHDLNAYRVLFDEEGDPRLSCFGFMRNSRDGKSYSTNLAYTPPEYLKHGRVTPESVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G067490`
TK1151 ID	TkA05G067490
OH-1004 ID	LXL04_019600
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G067490

Location Chr05:18014137-18018156 (+)

Description Similar to BSK1: Serine/threonine-protein kinase BSK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35230`	Serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973 BR-SIGNALING KINASE1 physically associates with FLAGELLIN SENSING2 and regulates plant innate immunity in Arabidopsis.2013 · DOI: 10.1105/tpc.112.107904
`At5g59010`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	A mutation in Arabidopsis BSK5 encoding a brassinosteroid-signaling kinase protein affects responses to salinity and abscisic acid.2012 · DOI: 10.1016/j.bbrc.2012.08.118
`At1g50990`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0542800`	Probable serine/threonine kinase that functions as a positive regulator of plant immunity.	OsBSK1-2, an Orthologous of AtBSK1, Is Involved in Rice Immunity.2017 · DOI: 10.3389/fpls.2017.00908
`Os04g0684200`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of BRI1.	OsBRI1 Activates BR Signaling by Preventing Binding between the TPR and Kinase Domains of OsBSK3 via Phosphorylation.2016 · DOI: 10.1104/pp.15.01668

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019600 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G50990

ath:AT4G35230

ath:AT5G59010

dosa:Os04g0684200

osa:9270011

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.636

Rank 1 · TkA05G067490 · TK1151

Cytoplasm0.243

Rank 2 · TkA05G067490 · TK1151

Nucleus0.237

Rank 3 · TkA05G067490 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA05G067490 · TK1151

Plastid0.034

Rank 5 · TkA05G067490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr98-335 aa

PF00069Pkinase98-333 aa

PF25575TPR_BSK1_C371-489 aa

PF07719TPR_2418-438 aa

PF00515TPR_1419-438 aa

PF07719TPR_2449-474 aa

PF00069Pkinase456-494 aa

PF00515TPR_1456-474 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G067490	`PF07714`	PK_Tyr_Ser-Thr	98	335	3.5e-26	92.8
TkA05G067490	`PF00069`	Pkinase	98	333	2e-25	90.4
TkA05G067490	`PF25575`	TPR_BSK1_C	371	489	1.4e-58	196.6
TkA05G067490	`PF07719`	TPR_2	418	438	0.089	13.7
TkA05G067490	`PF00515`	TPR_1	419	438	0.38	11.4
TkA05G067490	`PF07719`	TPR_2	449	474	0.089	13.7
TkA05G067490	`PF00069`	Pkinase	456	494	2e-25	90.4
TkA05G067490	`PF00515`	TPR_1	456	474	0.38	11.4
TkA05G067490	`PF07719`	TPR_2	483	508	0.089	13.7
TkA05G067490	`PF00515`	TPR_1	491	508	0.38	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944A7`	Arabidopsis thaliana	sp\|Q944A7\|BSK1_ARATH Serine/threonine-protein kinase BSK1	86.700%	Swiss-Prot	High
`Q9FIL1`	Arabidopsis thaliana	sp\|Q9FIL1\|BSK5_ARATH Serine/threonine-protein kinase BSK5	63.100%	Swiss-Prot	High
`F4I7Y4`	Arabidopsis thaliana	sp\|F4I7Y4\|BSK11_ARATH Serine/threonine-protein kinase BSK11	62.200%	Swiss-Prot	High
`Q336V9`	Oryza sativa subsp. japonica	sp\|Q336V9\|BSK12_ORYSJ Serine/threonine-protein kinase BSK1-2	76.100%	Swiss-Prot	High
`B9FDE0`	Oryza sativa subsp. japonica	sp\|B9FDE0\|BSK3_ORYSJ Probable serine/threonine-protein kinase BSK3	62.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card