TkA05G064570 | RubberDandelionOmics

Gene overview

TkA05G064570

Reference: TK1151 Chr: Chr05 Coordinates: 17230038-17234041 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1835 bp · TkA05G064570|TK1151|cDNA

GTTGCCAGTCCCTCTGCGGCCAATGACTTGGTCGTCTCCTCCACCCACACAAGATTAATATTAAACTTCTCTTCTCTCCATAAATGGTCACCATGACCAATTGCATTTCATTTGATCATCCAAATTCCCCGCAGAAAGAGGTTAAAACACCACTTTATAACAAAAAGAATTCCAGTCAAAGAAGCAAACAAGAAACCGATTTTGCTGATCGAAGACTGAATATTGAAATACATTGATAGAAGAAGAAGAAGAGCAATATT...

CDS

Download CDS FASTA

1254 bp · TkA05G064570|TK1151|CDS

ATGGGTGTTTGCTTTTCGTCTGCTTCTCCCACTAATAAAACGCCCAACACCACCGGCAATCTCAGTTCAGCAGCGATTTCACAGACCACCATCACCAGCACAACTACAAATTCATCATCGTCAGGAGTAAGCAGCCAGTTCTCGGCGGCAAGTGGTGGTGATGATCGACAGCCAGGCGGCCAGATCTTGCCCCATCCCAATCTTAGGATATTCAGCTTTGCTGAACTCAAATCCGCCACAAGAAATTTTAGAAGCGATAC...

Protein

Download Protein FASTA

417 aa · TkA05G064570|TK1151|PROTEIN

MGVCFSSASPTNKTPNTTGNLSSAAISQTTITSTTTNSSSSGVSSQFSAASGGDDRQPGGQILPHPNLRIFSFAELKSATRNFRSDTVLGEGGFGKVYKGWIEDKSNSKNNVIAVKKLNSESMQGLAEWQAEVDFLGRLSHPNLVKLLGYCYEGTELLLVYEFMQKGSLENHLFGRGSTVQPLPWDLRLKILIGAAEGLAFLHTSEKQVIYRDFKASNILLDGCYNAKISDFGLAKVGPSASQSHVTTRVMGTYGYAAPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G064570`
TK1151 ID	TkA05G064570
OH-1004 ID	LXL04_019575
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G064570

Location Chr05:17230038-17234041 (+)

Description Similar to PIX13: Probable serine/threonine-protein kinase PIX13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17220`	May be involved in plant defense signaling.	No verified direct reference in this release
`At4g35600`	Acts as a spatial inhibitor of signaling that modulates abscission zone cell adhesion and expansion.	No verified direct reference in this release
`At1g07570`	Possible bi-functional kinase.	Novel protein kinase of Arabidopsis thaliana (APK1) that phosphorylates tyrosine, serine and threonine.1992 · DOI: 10.1007/bf00046450
`At2g28930`	Possible bi-functional kinase.	Light-induced stomatal opening is affected by the guard cell protein kinase APK1b.2014 · DOI: 10.1371/journal.pone.0097161
`At5g02290`	May play a role in the regulation of plant growth and development (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019575 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009838 abscission Biological Process

GO:0060862 negative regulation of floral organ abscission Biological Process

GO:1902458 positive regulation of stomatal opening Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004713 protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G07570

ath:AT2G17220

ath:AT2G28930

ath:AT4G35600

ath:AT5G02290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.674

Rank 1 · TkA05G064570 · TK1151

Cytoplasm0.269

Rank 2 · TkA05G064570 · TK1151

Nucleus0.244

Rank 3 · TkA05G064570 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA05G064570 · TK1151

Golgi apparatus0.029

Rank 5 · TkA05G064570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase85-359 aa

PF07714PK_Tyr_Ser-Thr86-360 aa

PF01636APH131-165 aa

PF01636APH204-239 aa

PF01636APH282-316 aa

PF01636APH350-380 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G064570	`PF00069`	Pkinase	85	359	2.5e-47	162.2
TkA05G064570	`PF07714`	PK_Tyr_Ser-Thr	86	360	1.2e-49	169.7
TkA05G064570	`PF01636`	APH	131	165	0.15	12.5
TkA05G064570	`PF01636`	APH	204	239	0.15	12.5
TkA05G064570	`PF01636`	APH	282	316	0.15	12.5
TkA05G064570	`PF01636`	APH	350	380	0.15	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SII6`	Arabidopsis thaliana	sp\|Q9SII6\|PIX13_ARATH Probable serine/threonine-protein kinase PIX13	71.400%	Swiss-Prot	High
`P27450`	Arabidopsis thaliana	sp\|P27450\|CST_ARATH Probable serine/threonine-protein kinase CST	59.400%	Swiss-Prot	High
`Q06548`	Arabidopsis thaliana	sp\|Q06548\|PBL9_ARATH Probable serine/threonine-protein kinase PBL9	61.500%	Swiss-Prot	High
`P46573`	Arabidopsis thaliana	sp\|P46573\|PBL10_ARATH Probable serine/threonine-protein kinase PBL10	61.000%	Swiss-Prot	High
`P43293`	Arabidopsis thaliana	sp\|P43293\|PBL11_ARATH Probable serine/threonine-protein kinase PBL11	59.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card