TkA05G061570 | RubberDandelionOmics

Gene overview

TkA05G061570

Reference: TK1151 Chr: Chr05 Coordinates: 16388360-16391885 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1859 bp · TkA05G061570|TK1151|cDNA

CTTGTTCTTCCCTTCACCAAAATCGCATCTTCTGGAATCCTTCATCCTCATCATCATCAGAATCCAGGAGGAGCAGATGACGGCTATCTATGCGCTGTTTAGGTTTCTCCAATGGCAGTGGGGGGATGCAGAGGAGAAGCAAGAAAACAAGTGATGGATACAAATCAAATAGTAGGAGGTCAGCCGCTCGGAACCTAGTTCTCCAAAACGACTTTTTTTATAAACTCACCAAATGAGAACCTGATCAAGATGATGATGAA...

CDS

Download CDS FASTA

840 bp · TkA05G061570|TK1151|CDS

ATGAAGTGCGTTGGGTTGCAGTACCTGGAAGCAATTCGGAACCTCAAGGATTCGAAATTCGAGCCTGTTAGAACAATCTACATCTCGTTTGTCCCCGATGAGGAAATCGGTGGACTCGATGGGGCGAAGAGATTTGCGGATTCTAAAATGTTTGATGAGATGAATGTCGGGATCGTGTTGGATGAAGGATTAGCATCTCCGGATGATAAATACAGGTTGTTCTACGCGGAGAGACGTGCGATGGCGTTGGTGATAAAAGC...

Protein

Download Protein FASTA

279 aa · TkA05G061570|TK1151|PROTEIN

MKCVGLQYLEAIRNLKDSKFEPVRTIYISFVPDEEIGGLDGAKRFADSKMFDEMNVGIVLDEGLASPDDKYRLFYAERRAMALVIKATGAPGHGAKLYDNTAMENLMKSIESVRRFRASQFDLMKAGLMAEGEVISVNMVFLKAGTPSPTGFVMNLQPSEAEAGFDIRVPPIVDQASLERRIAEEWAPSSRNMTFEIRQFKPKVSKENRKSIVTTYDSSNPWWSLIEEAIVKAKGKFGKPEIFPASTDARYFRLKGVPAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G061570`
TK1151 ID	TkA05G061570
OH-1004 ID	LXL04_014102
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	55.000
Protein coverage (%)	TK1151 96.416 / OH-1004 61.503 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G061570`
Location	Chr05:16388360-16391885 (+)
Description	Similar to acy1: Aminoacylase-1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014102` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006520 amino acid metabolic process Biological Process GO:0030163 protein catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0004046 aminoacylase activity Molecular Function GO:0008463 formylmethionine deformylase activity Molecular Function GO:0042802 identical protein binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0270562 mmu:109652 rno:300981 ssc:396930 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.592

Rank 1 · TkA05G061570 · TK1151

Nucleus0.348

Rank 2 · TkA05G061570 · TK1151

Peroxisome0.090

Rank 3 · TkA05G061570 · TK1151

Mitochondrion0.061

Rank 4 · TkA05G061570 · TK1151

Extracellular0.059

Rank 5 · TkA05G061570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01546Peptidase_M201-262 aa

PF04389Peptidase_M289-72 aa

PF07687M20_dimer76-185 aa

PF04389Peptidase_M28218-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G061570	`PF01546`	Peptidase_M20	1	262	2.8e-14	54.2
TkA05G061570	`PF04389`	Peptidase_M28	9	72	2.8e-06	27.9
TkA05G061570	`PF07687`	M20_dimer	76	185	0.00024	21.7
TkA05G061570	`PF04389`	Peptidase_M28	218	265	2.8e-06	27.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card