TkA05G061280 | RubberDandelionOmics

Gene overview

TkA05G061280

Reference: TK1151 Chr: Chr05 Coordinates: 16305199-16309750 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2342 bp · TkA05G061280|TK1151|cDNA

AGCGGGTGGTGTGCTCAAGGAATTAACTTGGAGTGGTCTAACCTATTAAAAGACAAAAAAGTCGCACTTTTTTTTGCTGCCTTTCTTTGGGAATCTCCTCATCAAAACAGCTTTTTAACAAATTTCCCAGCAAAATTTCCATGAAAAATCGAAATCCCTTTTCTTTCTTGTTTCGTTTTCCCTCGGATTTATCTAAACGAATTGCTCAACCCTCTTCATAACAATCAATCTTTCAATCTGCACACACCCACACACAAACA...

CDS

Download CDS FASTA

1767 bp · TkA05G061280|TK1151|CDS

ATGATGCTTCCCGCCACAGCCTTTTCATCATCTTCATCTTCATCAGCTAATTCAGCTGTTGTTCGAGTGGATAAAGCCACCAGCGAATTCTTGAACGGCCCTGATTGGACTCTTAACATCGATATTTGCGACACCATCAACGCGAATCATTGGCTTGCAAAAGATGTTGTTAAGGCTTTAAAGAAAAGGTTACAACACAAGAACCCTCATGTTCAACTGCTTTGCTTGACGCTTTTAGAAACAATGGTAAAGAATTGTGG...

Protein

Download Protein FASTA

588 aa · TkA05G061280|TK1151|PROTEIN

MMLPATAFSSSSSSSANSAVVRVDKATSEFLNGPDWTLNIDICDTINANHWLAKDVVKALKKRLQHKNPHVQLLCLTLLETMVKNCGDNVHHQIAERNILPEMIKIVKKKTDMRVREKILVLLDSWQEAFGGRGGKYPQYYFAYDELRQSGVQFPHRSPDAAPIFTPPVTHPSFGPPQPNYGMPSNSSTRLDEAMASEIENLSLSVIESMRNVSDLLSEMLQEVDPNDRAAVKDEVIVDVVDRCRSNQKKLMQMLASTSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G061280`
TK1151 ID	TkA05G061280
OH-1004 ID	LXL04_019540
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G061280

Location Chr05:16305199-16309750 (+)

Description Similar to TOL6: TOM1-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38410`	Acts as a gatekeeper for degradative protein sorting to the vacuole.	No verified direct reference in this release
`At5g01760`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At4g32760`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At1g76970`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At1g21380`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019540 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005771 multivesicular body Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0031901 early endosome membrane Cellular Component

GO:0035091 phosphatidylinositol binding Molecular Function

GO:0043130 ubiquitin binding Molecular Function

KEGG gene cross-reference

ath:AT1G76970

ath:AT2G38410

ath:AT4G32760

ath:AT5G01760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.594

Rank 1 · TkA05G061280 · TK1151

Golgi apparatus0.311

Rank 2 · TkA05G061280 · TK1151

Nucleus0.146

Rank 3 · TkA05G061280 · TK1151

Cell membrane0.134

Rank 4 · TkA05G061280 · TK1151

Lysosome / Vacuole0.105

Rank 5 · TkA05G061280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00790VHS18-132 aa

PF01417ENTH18-97 aa

PF13646HEAT_230-73 aa

PF11099M11L41-109 aa

PF30746TMCO641-123 aa

PF16997Wap144-123 aa

PF14676FANCI_S244-119 aa

PF12348CLASP_N45-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G061280	`PF00790`	VHS	18	132	4.3e-35	121.3
TkA05G061280	`PF01417`	ENTH	18	97	0.0095	16.7
TkA05G061280	`PF13646`	HEAT_2	30	73	0.18	12.9
TkA05G061280	`PF11099`	M11L	41	109	0.0077	17.3
TkA05G061280	`PF30746`	TMCO6	41	123	0.21	11.0
TkA05G061280	`PF16997`	Wap1	44	123	0.016	15.1
TkA05G061280	`PF14676`	FANCI_S2	44	119	0.31	11.9
TkA05G061280	`PF12348`	CLASP_N	45	108	1.1	9.6
TkA05G061280	`PF03127`	GAT	50	75	1.1e-19	71.1
TkA05G061280	`PF04818`	CID	51	128	0.002	19.1
TkA05G061280	`PF24768`	ARM_ARMC5	51	116	0.13	12.4
TkA05G061280	`PF22964`	ZER1-like_2nd	53	120	0.097	12.0
TkA05G061280	`PF11841`	ELMO_ARM	54	123	0.013	16.1
TkA05G061280	`PF21041`	XMAP215_CLASP_TOG	54	120	0.022	15.2
TkA05G061280	`PF23227`	HEAT_MROH2B_C	56	119	0.14	12.2
TkA05G061280	`PF24181`	TPR_TTI1_C	58	114	0.00068	20.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80910`	Arabidopsis thaliana	sp\|O80910\|TOL6_ARATH TOM1-like protein 6	43.500%	Swiss-Prot	Medium
`F4KAU9`	Arabidopsis thaliana	sp\|F4KAU9\|TOL7_ARATH TOM1-like protein 7	54.500%	Swiss-Prot	Low
`Q8L860`	Arabidopsis thaliana	sp\|Q8L860\|TOL9_ARATH TOM1-like protein 9	50.600%	Swiss-Prot	Low
`Q6NQK0`	Arabidopsis thaliana	sp\|Q6NQK0\|TOL4_ARATH TOM1-like protein 4	45.900%	Swiss-Prot	Medium
`Q9LPL6`	Arabidopsis thaliana	sp\|Q9LPL6\|TOL3_ARATH TOM1-like protein 3	47.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card