TkA05G053260 | RubberDandelionOmics

Gene overview

TkA05G053260

Reference: TK1151 Chr: Chr05 Coordinates: 14170818-14172959 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · TkA05G053260|TK1151|cDNA

ATGTTGGCTGGTGCGGTGGGGTCCATCATGACATATCCTGGTCTCTATTTTGAGATCTTGGGTTCTTATACTTTGCCTGTTAGTGTTGTGAACTCCAATCAAGCAAAAGCTATCGCTACCTACATAAAATCAACAAGAAATGCAACTGCGGTAATAATGAAGAGTGAAGATGTAAAAAACGAGTCTGCCCCATTTGTTGCCTCTTTCTCTTCAAGAGGTCCAAATCCAATAAATAAAAACATCCTCAAGCCCGACCTAAC...

CDS

Download CDS FASTA

624 bp · TkA05G053260|TK1151|CDS

ATGTTGGCTGGTGCGGTGGGGTCCATCATGACATATCCTGGTCTCTATTTTGAGATCTTGGGTTCTTATACTTTGCCTGTTAGTGTTGTGAACTCCAATCAAGCAAAAGCTATCGCTACCTACATAAAATCAACAAGAAATGCAACTGCGGTAATAATGAAGAGTGAAGATGTAAAAAACGAGTCTGCCCCATTTGTTGCCTCTTTCTCTTCAAGAGGTCCAAATCCAATAAATAAAAACATCCTCAAGCCCGACCTAAC...

Protein

Download Protein FASTA

207 aa · TkA05G053260|TK1151|PROTEIN

MLAGAVGSIMTYPGLYFEILGSYTLPVSVVNSNQAKAIATYIKSTRNATAVIMKSEDVKNESAPFVASFSSRGPNPINKNILKPDLTAPGVRILAAWPHVAPFSQVKSDHRSVPFNIISGTSMACPHVAGIAAYCWNLEVKVQQFNLIISSLQSTNIKGTILVLLSSISLVTCWLLYMIFCTCEHAYKCSDYQEGNHTTHKHTCNWF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G053260`
TK1151 ID	TkA05G053260
OH-1004 ID	LXL04_019460
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.900
Protein coverage (%)	TK1151 64.734 / OH-1004 31.034 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G053260

Location Chr05:14170818-14172959 (+)

Description Similar to Cucumisin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46850`	Subtilisin-like protease SBT4.6.	No verified direct reference in this release
`At5g59100`	Subtilisin-like protease SBT4.4.	No verified direct reference in this release
`At5g58820`	Subtilisin-like protease SBT4.7.	No verified direct reference in this release
`At5g58840`	Subtilisin-like protease SBT4.9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019460 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G46850

ath:AT5G59100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.322

Rank 1 · TkA05G053260 · TK1151

Cytoplasm0.208

Rank 2 · TkA05G053260 · TK1151

Endoplasmic reticulum0.165

Rank 3 · TkA05G053260 · TK1151

Lysosome / Vacuole0.146

Rank 4 · TkA05G053260 · TK1151

Cell membrane0.124

Rank 5 · TkA05G053260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00082Peptidase_S834-138 aa

PF07379DUF1494123-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G053260	`PF00082`	Peptidase_S8	34	138	1.7e-13	51.2
TkA05G053260	`PF07379`	DUF1494	123	180	0.051	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STF7`	Arabidopsis thaliana	sp\|Q9STF7\|SBT46_ARATH Subtilisin-like protease SBT4.6	50.400%	Swiss-Prot	Medium
`Q9FGU3`	Arabidopsis thaliana	sp\|Q9FGU3\|SBT44_ARATH Subtilisin-like protease SBT4.4	49.600%	Swiss-Prot	Medium
`F4KGD4`	Arabidopsis thaliana	sp\|F4KGD4\|SBT47_ARATH Subtilisin-like protease SBT4.7	46.900%	Swiss-Prot	Medium
`Q9FIM5`	Arabidopsis thaliana	sp\|Q9FIM5\|SBT49_ARATH Subtilisin-like protease SBT4.9	50.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card