TkA05G051660 | RubberDandelionOmics

Gene overview

TkA05G051660

Reference: TK1151 Chr: Chr05 Coordinates: 13752352-13754557 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1260 bp · TkA05G051660|TK1151|cDNA

GCAATAGATGATCGTACAGAGTCATTTTCCCTTCTTTCTTCCACCAAACTCATTAAAACCTCCGGCTTGTGCATTGACATGGCGGAAGATAAATGTTTCGAGAGCCTTCAATCGCTGTCGCTTATAGTCGATCAATTTTGACCTAACTTATTTTTCCACATTGGGGGAAGAGGTGGTGTCATCAGCGATAGGTTATGGGGAGGATGATGGAGTGGGCGAGTAAGCCAAATCATTTGGGAGGTTTACCAAGAAGGACGGTG...

CDS

Download CDS FASTA

834 bp · TkA05G051660|TK1151|CDS

ATGGGGAGGATGATGGAGTGGGCGAGTAAGCCAAATCATTTGGGAGGTTTACCAAGAAGGACGGTGATAATGGCCGTCGGAACATTCTCAAAAGCGGTCGCGAATCTCATGAACTCTACTTCCGTTCATAACGCAGACGCTCTCCTTAACCTCGTCAGATCTCGACCTCCTGGTGTTCCTCTCATCACCGTTAGCAATCACATGTCCACGTTGGATGATCCTGTAATGTGGGGATTCAAAGGTTTCCCAACATGTAATGC...

Protein

Download Protein FASTA

277 aa · TkA05G051660|TK1151|PROTEIN

MGRMMEWASKPNHLGGLPRRTVIMAVGTFSKAVANLMNSTSVHNADALLNLVRSRPPGVPLITVSNHMSTLDDPVMWGFKGFPTCNADLQRWVLAAEDICFKNPVLSYFFRLGKCIPITRGGGIYQEHMNEALDRLSNGEWLHTFPEGKVCQEDEPIRRLKWGTASLIARSPVTPIVLPIVHHGFEKVMPETYMYGKRPPIPLWKKEIKIIIGEPIEFDIAKLKQTALSTSRNSQHFKNLGWPPFGGMDEVAQRCLYIDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G051660`
TK1151 ID	TkA05G051660
OH-1004 ID	LXL04_019435
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G051660

Location Chr05:13752352-13754557 (-)

Description Similar to At1g78690: N-acylphosphatidylethanolamine synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78690`	Acyltransferase that catalyzes the N-acylation of phosphatidylethanolamine to form N-acylphosphatidylethanolamine (N- acyl-PE) (e.g. NAPEs containing C16:0, C16:1, C18:0, and C18:1).	Putative N-acylphosphatidylethanolamine synthase from Arabidopsis thaliana is a lysoglycerophospholipid acyltransferase.2011 · DOI: 10.1074/jbc.m111.269779

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019435 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006650 glycerophospholipid metabolic process Biological Process

GO:0007007 inner mitochondrial membrane organization Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0032048 cardiolipin metabolic process Biological Process

GO:0035965 cardiolipin acyl-chain remodeling Biological Process

GO:0042407 cristae formation Biological Process

GO:0046471 phosphatidylglycerol metabolic process Biological Process

GO:1900210 positive regulation of cardiolipin metabolic process Biological Process

GO:2001171 positive regulation of ATP biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT1G78690

ggo:101147380

mmu:66826

ptr:449590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.795

Rank 1 · TkA05G051660 · TK1151

Cytoplasm0.090

Rank 2 · TkA05G051660 · TK1151

Endoplasmic reticulum0.088

Rank 3 · TkA05G051660 · TK1151

Peroxisome0.060

Rank 4 · TkA05G051660 · TK1151

Nucleus0.059

Rank 5 · TkA05G051660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01553Acyltransferase56-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G051660	`PF01553`	Acyltransferase	56	181	3.9e-18	66.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV87`	Arabidopsis thaliana	sp\|Q9ZV87\|NAPES_ARATH N-acylphosphatidylethanolamine synthase	66.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card