Gene Card
Gene overview
cDNA / CDS / Protein Sequences
438 bp · TkA05G029420|TK1151|cDNA
ATGGCTCCAAAAACGACCCCAACGGCTAGAAATGAAAACTGCCCGTTTTTTTGTTTTTTGCTCGATAAACCGGTTCGGGCGGATTCGGTTCTGAGATCCGGAAAAAATCCGACGCGGGAGCAGATTGGACAAACCGGTTCGGGTTCGGCGGATCGGATCGGCGGTTCGGTTCTGGTCAAAACCGGTTCGTTGACCGGATCGGATTCGGTTCTAGGCGCGGATCAGGTTCTCCTGTTCATCTCTACTTCTTTGGAATCAAA...
438 bp · TkA05G029420|TK1151|CDS
ATGGCTCCAAAAACGACCCCAACGGCTAGAAATGAAAACTGCCCGTTTTTTTGTTTTTTGCTCGATAAACCGGTTCGGGCGGATTCGGTTCTGAGATCCGGAAAAAATCCGACGCGGGAGCAGATTGGACAAACCGGTTCGGGTTCGGCGGATCGGATCGGCGGTTCGGTTCTGGTCAAAACCGGTTCGTTGACCGGATCGGATTCGGTTCTAGGCGCGGATCAGGTTCTCCTGTTCATCTCTACTTCTTTGGAATCAAA...
Protein
Download Protein FASTA145 aa · TkA05G029420|TK1151|PROTEIN
MAPKTTPTARNENCPFFCFLLDKPVRADSVLRSGKNPTREQIGQTGSGSADRIGGSVLVKTGSLTGSDSVLGADQVLLFISTSLESNSYTDWIFSNYYRAIDFVVANKELPVKAPELPDLLKQGKIWVRQLRLYARYSNLSGLGS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G029420 |
|---|---|
| TK1151 ID | TkA05G029420 |
| OH-1004 ID | LXL04_029588 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 56.900 |
| Protein coverage (%) | TK1151 35.172 / OH-1004 6.916Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G029420 |
|---|---|
| Location | Chr05:7932040-7932543 (-) |
| Description | Similar to PIAL2: E4 SUMO-protein ligase PIAL2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0007059 chromosome segregation Biological Process GO:0007131 reciprocal meiotic recombination Biological Process GO:0016925 protein sumoylation Biological Process GO:0030999 linear element assembly Biological Process GO:0031297 replication fork processing Biological Process GO:0036299 non-recombinational interstrand cross-link repair Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0060966 regulation of gene silencing by regulatory ncRNA Biological Process GO:0072766 centromere clustering at the mitotic interphase nuclear envelope Biological Process GO:0120290 stalled replication fork localization to nuclear periphery Biological Process |
| KEGG gene cross-reference | ath:AT1G08910 ath:AT5G41580 hsa:83637 sce:YOR156C spo:2541580 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF26716PIAL1_N98-124 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G029420 | PF26716 | PIAL1_N | 98 | 124 | 0.00027 | 21.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.