TkA05G005040 | RubberDandelionOmics

Gene overview

TkA05G005040

Reference: TK1151 Chr: Chr05 Coordinates: 1474693-1479426 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1556 bp · TkA05G005040|TK1151|cDNA

AGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAAGTGAAGAGAAGAGAAAAGAGAAGGAATTTTGTAAAGAGAATGACAGAAATCAAATTCAGGCTGAATTTTGAAGAAGAATTATTATATTCGGTGTCTGAGATTGTATACTGCAGAATTTGTCACGAAGGAGAGTTCGAAAGCTGTAAAAGCTTGGAAACTCCATGTTCTTGTTCTGGAACCCTCAAGTTTGCTCACAGAGATTGCGTACAGAGATGGTG...

CDS

Download CDS FASTA

624 bp · TkA05G005040|TK1151|CDS

ATGACAGAAATCAAATTCAGGCTGAATTTTGAAGAAGAATTATTATATTCGGTGTCTGAGATTGTATACTGCAGAATTTGTCACGAAGGAGAGTTCGAAAGCTGTAAAAGCTTGGAAACTCCATGTTCTTGTTCTGGAACCCTCAAGTTTGCTCACAGAGATTGCGTACAGAGATGGTGTGATGAGAAGGGAAACACTATTTGCGAAATTTGTCTCCAGAAATTTGAACCAGGCTACTCAGCCCCACCCCCCAACAAACA...

Protein

Download Protein FASTA

207 aa · TkA05G005040|TK1151|PROTEIN

MTEIKFRLNFEEELLYSVSEIVYCRICHEGEFESCKSLETPCSCSGTLKFAHRDCVQRWCDEKGNTICEICLQKFEPGYSAPPPNKQVDATRVTIRLEVPTRDDEEEESLVEREFAECSSAADTAASMCRTLAVIFTVLLLVRHFIAVVMGETGDYPFTILTLLVIKASGILFPMYIIMRFIDVVHNSITSRYQDSNNTEEEGHENV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G005040`
TK1151 ID	TkA05G005040
OH-1004 ID	LXL04_018942
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G005040`
Location	Chr05:1474693-1479426 (+)
Description	Similar to MARCHF2: E3 ubiquitin-protein ligase MARCHF2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018942` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000209 protein polyubiquitination Biological Process GO:0002495 antigen processing and presentation of peptide antigen via MHC class II Biological Process GO:0006897 endocytosis Biological Process GO:0006955 immune response Biological Process GO:0016567 protein ubiquitination Biological Process GO:0044790 suppression of viral release by host Biological Process GO:0140367 antibacterial innate immune response Biological Process GO:0140374 antiviral innate immune response Biological Process GO:1905167 positive regulation of lysosomal protein catabolic process Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005764 lysosome Cellular Component
KEGG gene cross-reference	bta:508949 hsa:51257 mmu:224703 rno:362849 xtr:448095 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.347

Rank 1 · TkA05G005040 · TK1151

Endoplasmic reticulum0.251

Rank 2 · TkA05G005040 · TK1151

Cell membrane0.236

Rank 3 · TkA05G005040 · TK1151

Cytoplasm0.197

Rank 4 · TkA05G005040 · TK1151

Golgi apparatus0.171

Rank 5 · TkA05G005040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12906RINGv24-71 aa

PF13639zf-RING_224-71 aa

PF13639zf-RING_267-79 aa

PF12428DUF367577-182 aa

PF23955DUF728481-120 aa

PF20872MalF_N_TM137-171 aa

PF12906RINGv183-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G005040	`PF12906`	RINGv	24	71	1.2e-13	51.7
TkA05G005040	`PF13639`	zf-RING_2	24	71	0.2	12.6
TkA05G005040	`PF13639`	zf-RING_2	67	79	0.2	12.6
TkA05G005040	`PF12428`	DUF3675	77	182	4.9e-28	98.8
TkA05G005040	`PF23955`	DUF7284	81	120	0.1	13.2
TkA05G005040	`PF20872`	MalF_N_TM	137	171	0.099	13.1
TkA05G005040	`PF12906`	RINGv	183	199	1.2e-13	51.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card