TkA04G510980 | RubberDandelionOmics

Gene overview

TkA04G510980

Reference: TK1151 Chr: Chr04 Coordinates: 129052125-129053253 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA04G510980|TK1151|cDNA

ATGTTCGATTGCTATGGAGTTCAATCAGAAGTCGGCTCAGAATCTGAAATCGAGAAGATAAAAAAAGGAGATATCCTATTCGATAAACAAGAAGATGGAAATGGGAATCTGAATTTGTTGTTGATGTCAAATGGATCTCCTGAACCAACATCATCATCTTTGAAATTAGACAATCTTACTATTCCTGAGAAGAAGAGAAGAGGGAGATCCGGGCAAAAGCATCATATTTTTCATTTACGAAAACCCATAATAGATGTCTC...

CDS

Download CDS FASTA

411 bp · TkA04G510980|TK1151|CDS

ATGTTCGATTGCTATGGAGTTCAATCAGAAGTCGGCTCAGAATCTGAAATCGAGAAGATAAAAAAAGGAGATATCCTATTCGATAAACAAGAAGATGGAAATGGGAATCTGAATTTGTTGTTGATGTCAAATGGATCTCCTGAACCAACATCATCATCTTTGAAATTAGACAATCTTACTATTCCTGAGAAGAAGAGAAGAGGGAGATCCGGGCAAAAGCATCATATTTTTCATTTACGAAAACCCATAATAGATGTCTC...

Protein

Download Protein FASTA

136 aa · TkA04G510980|TK1151|PROTEIN

MFDCYGVQSEVGSESEIEKIKKGDILFDKQEDGNGNLNLLLMSNGSPEPTSSSLKLDNLTIPEKKRRGRSGQKHHIFHLRKPIIDVSIHLVGGVTPKKGATEHLGLPVFNSIVDAKAETKAKASVSYVPREWLEPA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G510980`
TK1151 ID	TkA04G510980
OH-1004 ID	LXL04_036755
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.000
Protein coverage (%)	TK1151 73.529 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G510980

Location Chr04:129052125-129053253 (+)

Description Similar to Os07g0577700: Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23250`	Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA.	No verified direct reference in this release
`At5g08300`	Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0577700`	Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036755 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006104 succinyl-CoA metabolic process Biological Process

GO:0006105 succinate metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009361 succinate-CoA ligase complex (ADP-forming) Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004775 succinate-CoA ligase (ADP-forming) activity Molecular Function

GO:0004776 succinate-CoA ligase (GDP-forming) activity Molecular Function

GO:0005507 copper ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G08300

ath:AT5G23250

sly:543943

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.640

Rank 1 · TkA04G510980 · TK1151

Cytoplasm0.294

Rank 2 · TkA04G510980 · TK1151

Cell membrane0.085

Rank 3 · TkA04G510980 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA04G510980 · TK1151

Mitochondrion0.048

Rank 5 · TkA04G510980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02629CoA_binding84-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G510980	`PF02629`	CoA_binding	84	131	3.2e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LAD2`	Arabidopsis thaliana	sp\|Q8LAD2\|SUCA2_ARATH Succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial	61.400%	Swiss-Prot	Low
`P68209`	Arabidopsis thaliana	sp\|P68209\|SUCA1_ARATH Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial	61.400%	Swiss-Prot	Low
`Q6ZL94`	Oryza sativa subsp. japonica	sp\|Q6ZL94\|SUCA_ORYSJ Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial	64.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card