TkA04G475090 | RubberDandelionOmics

Gene overview

TkA04G475090

Reference: TK1151 Chr: Chr04 Coordinates: 119982474-119985252 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1074 bp · TkA04G475090|TK1151|cDNA

AACCGACCCGATAGTATTTGTATTCAAGATCCAAATCCACCTCACAGAAAACCCGTCTGAGATACGAGATCGACGCACAGCTACGATTAGCTTCGCAACTACGCGGTGGGCTAAACATCCTTCCCCTGATTAAACCCTACAAACAAAACTTCGCGAGGGTGCTGTTCGCCTCTACCGATTGAAATGTTCAAAAAGTTTACTTCAGAAGAGGTATCTGGGCAAAATCAAGTCAAAGCTTCTGTGCAACGAAGAATTCGACA...

CDS

Download CDS FASTA

546 bp · TkA04G475090|TK1151|CDS

ATGTTCAAAAAGTTTACTTCAGAAGAGGTATCTGGGCAAAATCAAGTCAAAGCTTCTGTGCAACGAAGAATTCGACAAAGTATTGCTGATGAGTACCCAGGACTAGAGCTAGTTATGGATGATCTTCTTCCAAAGAAGTCTCCTCTCATTGTTGCTAAATGTCAAAACCATCTGAATTTGGTAGTGGTGAACAATGTTCCACTTTTTTTCAACATACGTGATGGCCCATATATGCCTACACTAAGACTCCTTCATCAATA...

Protein

Download Protein FASTA

181 aa · TkA04G475090|TK1151|PROTEIN

MFKKFTSEEVSGQNQVKASVQRRIRQSIADEYPGLELVMDDLLPKKSPLIVAKCQNHLNLVVVNNVPLFFNIRDGPYMPTLRLLHQYPTIMKKLQVDRGAIKFVLAGANIMCPGLTSPGGILDEEVGAETPVAIMAEGKEHALAIGFTKMSAKDIKAINKGIGVDNMHYLNDGLWKMERLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G475090`
TK1151 ID	TkA04G475090
OH-1004 ID	LXL04_030516
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.700
Protein coverage (%)	TK1151 71.271 / OH-1004 39.796 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G475090`
Location	Chr04:119982474-119985252 (-)
Description	Similar to mcts1: Malignant T-cell-amplified sequence 1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030516` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001731 formation of translation preinitiation complex Biological Process GO:0002188 translation reinitiation Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006974 DNA damage response Biological Process GO:0032790 ribosome disassembly Biological Process GO:0075522 IRES-dependent viral translational initiation Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0000339 RNA cap binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003743 translation initiation factor activity Molecular Function GO:0043024 ribosomal small subunit binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0271910 hsa:28985 mmu:66405 rno:302500 xla:503679 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.737

Rank 1 · TkA04G475090 · TK1151

Nucleus0.417

Rank 2 · TkA04G475090 · TK1151

Mitochondrion0.079

Rank 3 · TkA04G475090 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA04G475090 · TK1151

Cell membrane0.038

Rank 5 · TkA04G475090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17832Pre-PUA7-88 aa

PF03909BSD13-46 aa

PF09183DUF194757-85 aa

PF01472PUA92-170 aa

PF26292PUA_elF2D99-172 aa

PF09183DUF1947150-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G475090	`PF17832`	Pre-PUA	7	88	1.9e-27	96.4
TkA04G475090	`PF03909`	BSD	13	46	0.028	15.1
TkA04G475090	`PF09183`	DUF1947	57	85	0.33	11.8
TkA04G475090	`PF01472`	PUA	92	170	5.5e-16	59.0
TkA04G475090	`PF26292`	PUA_elF2D	99	172	4.5e-13	49.5
TkA04G475090	`PF09183`	DUF1947	150	160	0.33	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card