Gene Card
Gene overview
cDNA / CDS / Protein Sequences
630 bp · TkA04G444240|TK1151|cDNA
CATTTGCCACCATGACTTGAGCCTGCGAGAACCAGGATGTTTCCTTTTGCAATTTGTCAACTTAGCCACACCTATATATAAACGATCACTACCACTTCCCACAAACATCACAATTCATCTCTCTTTCTCTCTAGATTATATCTCTCACTGAAAACAATAATGAGACCATCCAACTCTGAACTCGGGGCAGTTTCTCTTATTGCTTCAATCCTAATAGTAGCAGCATCCGCAGGAAGTTTTCACGATGATATTGACATCAC...
471 bp · TkA04G444240|TK1151|CDS
ATGAGACCATCCAACTCTGAACTCGGGGCAGTTTCTCTTATTGCTTCAATCCTAATAGTAGCAGCATCCGCAGGAAGTTTTCACGATGATATTGACATCACATTTGGAGGCGAACGTGCTAAAATTCTGAATGGGGGTCAGGATCTTTCTCTTTCTCTGGACCAATACTCTGGCGCTGGTTTCCAGTCAAAGCACGAGTACCTCTTCGGAAGATTCGACATGCAACTCAAACTCGTACCAGGCAACTCCGCTGGCACCGT...
Protein
Download Protein FASTA156 aa · TkA04G444240|TK1151|PROTEIN
MRPSNSELGAVSLIASILIVAASAGSFHDDIDITFGGERAKILNGGQDLSLSLDQYSGAGFQSKHEYLFGRFDMQLKLVPGNSAGTVTTFYLSSKGAGHDEIDFEFLGNSTGNPYTIHTNVYSRERRQRTAVPLWFDPRPPSTPTPSFGTAKGAVS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G444240 |
|---|---|
| TK1151 ID | TkA04G444240 |
| OH-1004 ID | LXL04_038583 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 87.100 |
| Protein coverage (%) | TK1151 88.462 / OH-1004 48.432Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G444240 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:111980429-111981221 (+) | |||||||||
| Description | Similar to Xyloglucan endotransglucosylase/hydrolase 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009408 response to heat Biological Process GO:0009409 response to cold Biological Process GO:0009612 response to mechanical stimulus Biological Process GO:0009664 plant-type cell wall organization Biological Process GO:0009733 response to auxin Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009834 plant-type secondary cell wall biogenesis Biological Process GO:0009835 fruit ripening Biological Process GO:0010218 response to far red light Biological Process GO:0010411 xyloglucan metabolic process Biological Process GO:0042546 cell wall biogenesis Biological Process GO:0071456 cellular response to hypoxia Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G23730 ath:AT4G14130 ath:AT5G57560 gmx:547802 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00722Glyco_hydro_1628-138 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G444240 | PF00722 | Glyco_hydro_16 | 28 | 138 | 4.4e-29 | 101.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.