TkA04G431030 | RubberDandelionOmics

Gene overview

TkA04G431030

Reference: TK1151 Chr: Chr04 Coordinates: 108699868-108700341 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · TkA04G431030|TK1151|cDNA

ATGGATACCATAAAGAATAACGGTGAAGAAAACCCAGATAATCAAAAAAGGTGGCTGAATCTAACCCTAGCTCCTCCATATCTACGAGAATCTTGTTCCAATAACTCAAGACCCACAACCACCTCAGTGAAGGTATACACGTGCAGTTTTTGCAAGAGAAAGTTCCACAGTTCACAAGCATTAGGAGGCCATCAAAATGCTCACAGAAGAGAGAGAGATGCAGCTCGAAGATACTATTCCCGAATCCCGATGAACTCCTT...

CDS

Download CDS FASTA

474 bp · TkA04G431030|TK1151|CDS

ATGGATACCATAAAGAATAACGGTGAAGAAAACCCAGATAATCAAAAAAGGTGGCTGAATCTAACCCTAGCTCCTCCATATCTACGAGAATCTTGTTCCAATAACTCAAGACCCACAACCACCTCAGTGAAGGTATACACGTGCAGTTTTTGCAAGAGAAAGTTCCACAGTTCACAAGCATTAGGAGGCCATCAAAATGCTCACAGAAGAGAGAGAGATGCAGCTCGAAGATACTATTCCCGAATCCCGATGAACTCCTT...

Protein

Download Protein FASTA

157 aa · TkA04G431030|TK1151|PROTEIN

MDTIKNNGEENPDNQKRWLNLTLAPPYLRESCSNNSRPTTTSVKVYTCSFCKRKFHSSQALGGHQNAHRRERDAARRYYSRIPMNSFDQTLRAHSFVQNPGRDEEATVARFTDLNGARYAYGGEEEANMNWPGSFYLNRQPICQQSDPCWLDLNLKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G431030`
TK1151 ID	TkA04G431030
OH-1004 ID	LXL04_038454
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G431030

Location Chr04:108699868-108700341 (-)

Description Similar to ZFP4: Zinc finger protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48890`	Acts as a transcriptional repressor.	LATE, a C(2)H(2) zinc-finger protein that acts as floral repressor.2011 · DOI: 10.1111/j.1365-313x.2011.04717.x
`At1g80730`	May play a role in the regulation of shoot development, downstream of photomorphogenic activation (Probable).	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294 Expression analysis of an Arabidopsis C2H2 zinc finger protein gene.1996 · DOI: 10.1007/bf00020477
`At5g14010`	May function as a transcriptional repressor of cellular proliferation that regulates floral determinacy and relative size of basal pattern elements along the proximo-distal axis of the developing gynoecium.	No verified direct reference in this release
`At5g25160`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At1g24625`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038454 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

KEGG gene cross-reference

ath:AT1G66140

ath:AT1G80730

ath:AT5G14010

ath:AT5G25160

ath:AT5G48890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA04G431030 · TK1151

Cytoplasm0.099

Rank 2 · TkA04G431030 · TK1151

Cell membrane0.031

Rank 3 · TkA04G431030 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA04G431030 · TK1151

Plastid0.010

Rank 5 · TkA04G431030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23320Zn_SUZ1232-66 aa

PF13912zf-C2H2_645-71 aa

PF13894zf-C2H2_446-68 aa

PF00096zf-C2H246-68 aa

PF13913zf-C2HC_247-58 aa

PF13894zf-C2H2_489-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G431030	`PF23320`	Zn_SUZ12	32	66	0.15	12.6
TkA04G431030	`PF13912`	zf-C2H2_6	45	71	2.4e-06	28.1
TkA04G431030	`PF13894`	zf-C2H2_4	46	68	0.0038	18.5
TkA04G431030	`PF00096`	zf-C2H2	46	68	0.14	13.4
TkA04G431030	`PF13913`	zf-C2HC_2	47	58	0.091	13.2
TkA04G431030	`PF13894`	zf-C2H2_4	89	94	0.0038	18.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKA9`	Arabidopsis thaliana	sp\|Q9FKA9\|LATE_ARATH Protein LATE FLOWERING	47.900%	Swiss-Prot	Low
`Q42485`	Arabidopsis thaliana	sp\|Q42485\|ZFP1_ARATH Zinc finger protein 1	56.000%	Swiss-Prot	Low
`Q9FFX4`	Arabidopsis thaliana	sp\|Q9FFX4\|KNU_ARATH Zinc finger protein KNUCKLES	57.100%	Swiss-Prot	Low
`Q39262`	Arabidopsis thaliana	sp\|Q39262\|ZFP3_ARATH Zinc finger protein 3	58.100%	Swiss-Prot	Low
`Q39266`	Arabidopsis thaliana	sp\|Q39266\|ZFP7_ARATH Zinc finger protein 7	67.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card