Gene Card
Gene overview
cDNA / CDS / Protein Sequences
315 bp · TkA04G375730|TK1151|cDNA
ATGAACTCACCAACCTTTGTGTTGACACTTTCAAAACTCATGCAATCTCAGAAAGTTGATAGCAGCCAAGGCATCTGCACAGGTAGCTTGACCGCCTTACCCGTCATTGAAACACAAGCTGGAGACGCTTTAGGTATCAGTACTATGGCTTTCAACCTAAATGGTTTCAATTTCAACCAATCCCTCCTCGCCCCATTCAATAGAAAGTTGACTTACACGCCTTACTTGATAGGAGGCTTCAGGGAAAAAGATCCGAGAGT...
315 bp · TkA04G375730|TK1151|CDS
ATGAACTCACCAACCTTTGTGTTGACACTTTCAAAACTCATGCAATCTCAGAAAGTTGATAGCAGCCAAGGCATCTGCACAGGTAGCTTGACCGCCTTACCCGTCATTGAAACACAAGCTGGAGACGCTTTAGGTATCAGTACTATGGCTTTCAACCTAAATGGTTTCAATTTCAACCAATCCCTCCTCGCCCCATTCAATAGAAAGTTGACTTACACGCCTTACTTGATAGGAGGCTTCAGGGAAAAAGATCCGAGAGT...
Protein
Download Protein FASTA104 aa · TkA04G375730|TK1151|PROTEIN
MNSPTFVLTLSKLMQSQKVDSSQGICTGSLTALPVIETQAGDALGISTMAFNLNGFNFNQSLLAPFNRKLTYTPYLIGGFREKDPRVLTVVGSAPFSNQNNSER
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G375730 |
|---|---|
| TK1151 ID | TkA04G375730 |
| OH-1004 ID | LXL04_023270 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 70.600 |
| Protein coverage (%) | TK1151 32.692 / OH-1004 8.010Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G375730 |
|---|---|
| Location | Chr04:94690239-94690898 (+) |
| Description | Similar to psbA: Photosystem II protein D1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009635 response to herbicide Biological Process GO:0009772 photosynthetic electron transport in photosystem II Biological Process GO:0009523 photosystem II Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0005506 iron ion binding Molecular Function GO:0009055 electron transfer activity Molecular Function GO:0010242 oxygen evolving activity Molecular Function GO:0016168 chlorophyll binding Molecular Function GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor Molecular Function |
| KEGG gene cross-reference | No functional description available |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.