Gene Card
Gene overview
cDNA / CDS / Protein Sequences
639 bp · TkA04G356290|TK1151|cDNA
ATGTTCGGGGTACTGTTTGGGGGGAAAATAGCAACAATTAATGAAGATCTAATGAAAATTGGGCTGAATTTGGAAGACATGCTATACGAGGAACCCTGCAACGAAGAGCCAGCAGCAACAAGATGGAGATGGGGGTTGGAAGCTGACACACAATTCACTTCCAAGTCGCTAAGAAAGGCCATTGACGAACTTCAAAACAGGCTGGCCACAAGAGCAAACCTCTCCAAACGGGGCGTGTCGGTCCCCTCTCAGGTCTGCGC...
639 bp · TkA04G356290|TK1151|CDS
ATGTTCGGGGTACTGTTTGGGGGGAAAATAGCAACAATTAATGAAGATCTAATGAAAATTGGGCTGAATTTGGAAGACATGCTATACGAGGAACCCTGCAACGAAGAGCCAGCAGCAACAAGATGGAGATGGGGGTTGGAAGCTGACACACAATTCACTTCCAAGTCGCTAAGAAAGGCCATTGACGAACTTCAAAACAGGCTGGCCACAAGAGCAAACCTCTCCAAACGGGGCGTGTCGGTCCCCTCTCAGGTCTGCGC...
Protein
Download Protein FASTA212 aa · TkA04G356290|TK1151|PROTEIN
MFGVLFGGKIATINEDLMKIGLNLEDMLYEEPCNEEPAATRWRWGLEADTQFTSKSLRKAIDELQNRLATRANLSKRGVSVPSQVCAWCNRYEETENHLFLECSIAVEVQAHLINWWGVNGLPRRISEVSDLFTEEFRTKSTKIEVAKELICQPFGTIHALEKPFTPPMGLFTPPAFWLRLFTPQAPLWEPFTPPPDWRIAIDASLRPFTPP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G356290 |
|---|---|
| TK1151 ID | TkA04G356290 |
| OH-1004 ID | LXL04_013363 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 36.300 |
| Protein coverage (%) | TK1151 66.509 / OH-1004 38.710Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G356290 |
|---|---|
| Location | Chr04:89852292-89853791 (-) |
| Description | Similar to MIF3: Mini zinc finger protein 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009640 photomorphogenesis Biological Process GO:0009733 response to auxin Biological Process GO:0009735 response to cytokinin Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009739 response to gibberellin Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0010582 floral meristem determinacy Biological Process GO:0035670 plant-type ovary development Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0048509 regulation of meristem development Biological Process |
| KEGG gene cross-reference | ath:AT1G18835 ath:AT1G74660 ath:AT3G28917 ath:AT5G60480 dosa:Os08g0438100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13966zf-RVT64-108 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G356290 | PF13966 | zf-RVT | 64 | 108 | 9.2e-10 | 39.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.