TkA04G239680 | RubberDandelionOmics

Gene overview

TkA04G239680

Reference: TK1151 Chr: Chr04 Coordinates: 60807677-60809882 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · TkA04G239680|TK1151|cDNA

ATGTTTAGTGCCGGTTATGGTGGTTTTTGCGACTGTCTCTCTCAATCTCTCAATGTTTCGTTTGAATTGCAACTCCATGTGGACCTAGACCAGGTAATCTACCGCCGAAATTATAACCTAAAAGAAACCGGAGCTTTGCTCGTCAAAGGTCCCCGATGTTCTGCTCAAGATAACGATCGGTTTATAGATATGATGGAGAAGTATTTCGAACAGTCGGATGAGTTTAAACATCTCCAAGAGCGTCCTCACCTCCATTATCA...

CDS

Download CDS FASTA

816 bp · TkA04G239680|TK1151|CDS

ATGTTTAGTGCCGGTTATGGTGGTTTTTGCGACTGTCTCTCTCAATCTCTCAATGTTTCGTTTGAATTGCAACTCCATGTGGACCTAGACCAGGTAATCTACCGCCGAAATTATAACCTAAAAGAAACCGGAGCTTTGCTCGTCAAAGGTCCCCGATGTTCTGCTCAAGATAACGATCGGTTTATAGATATGATGGAGAAGTATTTCGAACAGTCGGATGAGTTTAAACATCTCCAAGAGCGTCCTCACCTCCATTATCA...

Protein

Download Protein FASTA

271 aa · TkA04G239680|TK1151|PROTEIN

MFSAGYGGFCDCLSQSLNVSFELQLHVDLDQVIYRRNYNLKETGALLVKGPRCSAQDNDRFIDMMEKYFEQSDEFKHLQERPHLHYQESLNSKLKRTSTDSPWFVFGVSYSGALSAWFRLKFPHFTCGSLASSVVVNVVYNFTEFDQQVGESAGPECKAVLQEVTRLVEEKLASNSKALKTTFGATHKFLEICKVNVGSKIVFTNGSQDPWRASKQVLTPSMLSYIIGCHNCGHGTDIRQVEEAEAQQDRLRAYIMNQSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G239680`
TK1151 ID	TkA04G239680
OH-1004 ID	LXL04_013807
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.500
Protein coverage (%)	TK1151 56.827 / OH-1004 50.540 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G239680

Location Chr04:60807677-60809882 (+)

Description Similar to EDA2: Probable serine protease EDA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18080`	May be involved in a proteolytic pathway controlling the nuclear division phase of megagametogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013807 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005768 endosome Cellular Component

GO:0045121 membrane raft Cellular Component

GO:0008236 serine-type peptidase activity Molecular Function

GO:0008239 dipeptidyl-peptidase activity Molecular Function

GO:0070008 serine-type exopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G18080

cel:CELE_F56F10.1

cel:CELE_K12H4.7

hsa:10279

mmu:54373

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.346

Rank 1 · TkA04G239680 · TK1151

Cytoplasm0.231

Rank 2 · TkA04G239680 · TK1151

Nucleus0.108

Rank 3 · TkA04G239680 · TK1151

Mitochondrion0.097

Rank 4 · TkA04G239680 · TK1151

Endoplasmic reticulum0.094

Rank 5 · TkA04G239680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15118DUF45605-24 aa

PF05577Peptidase_S2890-188 aa

PF15118DUF4560116-138 aa

PF05577Peptidase_S28196-246 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G239680	`PF15118`	DUF4560	5	24	0.029	15.0
TkA04G239680	`PF05577`	Peptidase_S28	90	188	9.4e-23	81.4
TkA04G239680	`PF15118`	DUF4560	116	138	0.029	15.0
TkA04G239680	`PF05577`	Peptidase_S28	196	246	9.4e-23	81.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PF50`	Arabidopsis thaliana	sp\|Q1PF50\|EDA2_ARATH Probable serine protease EDA2	65.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card