Gene Card
Gene overview
cDNA / CDS / Protein Sequences
665 bp · TkA04G199610|TK1151|cDNA
AAGAAATTCATTCGAAAACCAACACCATATAAACCTCTCATCCATTCTTCCTTGTTTGCCTCATCGAATCATCAGACCGGTCTCCGATTTTTAGCAAACATGGATTCTAGCAGAGGCCAAAATGGGATTCAACTCTTGTTAGCTGCAGAACAAGAAGCTCAGCAAATTGTCACTACTGCTCGAAATGCAAAAATGGCTAGACTAAAACAAGCAAAAGAAGAGGCAGAGAAGGAGATTGCAGAATTCCGTGCTCAAATGGA...
432 bp · TkA04G199610|TK1151|CDS
AAGAAATTCATTCGAAAACCAACACCATATAAACCTCTCATCCATTCTTCCTTGTTTGCCTCATCGAATCATCAGACCGGTCTCCGATTTTTAGCAAACATGGATTCTAGCAGAGGCCAAAATGGGATTCAACTCTTGTTAGCTGCAGAACAAGAAGCTCAGCAAATTGTCACTACTGCTCGAAATGCAAAAATGGCTAGACTAAAACAAGCAAAAGAAGAGGCAGAGAAGGAGATTGCAGAATTCCGTGCTCAAATGGA...
Protein
Download Protein FASTA143 aa · TkA04G199610|TK1151|PROTEIN
KKFIRKPTPYKPLIHSSLFASSNHQTGLRFLANMDSSRGQNGIQLLLAAEQEAQQIVTTARNAKMARLKQAKEEAEKEIAEFRAQMEADYQRKLTETSGDSGANVKRLEKETNEKIKHLKTEAERISSDVVEMLLKHVTSVRY
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G199610 |
|---|---|
| TK1151 ID | TkA04G199610 |
| OH-1004 ID | LXL04_012675 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 56.900 |
| Protein coverage (%) | TK1151 76.224 / OH-1004 99.091Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G199610 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:51384099-51386038 (+) | |||||||||
| Description | Similar to VATG: V-type proton ATPase subunit G | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain Cellular Component GO:0000325 plant-type vacuole Cellular Component GO:0005773 vacuole Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0010494 cytoplasmic stress granule Cellular Component GO:0016469 proton-transporting two-sector ATPase complex Cellular Component GO:0016887 ATP hydrolysis activity Molecular Function GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Molecular Function GO:0046961 proton-transporting ATPase activity, rotational mechanism Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G01390 ath:AT4G23710 ath:AT4G25950 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03179V-ATPase_G39-141 aaPF14942Muted40-96 aaPF16999V-ATPase_G_243-118 aaPF15883DUF473645-137 aaPF28006HpsJ48-124 aaPF00430ATP-synt_B49-134 aaPF14362DUF440750-123 aaPF30319HI_023352-74 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G199610 | PF03179 | V-ATPase_G | 39 | 141 | 8.6e-33 | 113.8 |
| TkA04G199610 | PF14942 | Muted | 40 | 96 | 0.027 | 15.4 |
| TkA04G199610 | PF16999 | V-ATPase_G_2 | 43 | 118 | 4.2 | 8.8 |
| TkA04G199610 | PF15883 | DUF4736 | 45 | 137 | 0.34 | 11.4 |
| TkA04G199610 | PF28006 | HpsJ | 48 | 124 | 4.8 | 7.5 |
| TkA04G199610 | PF00430 | ATP-synt_B | 49 | 134 | 5.7 | 7.7 |
| TkA04G199610 | PF14362 | DUF4407 | 50 | 123 | 1.4 | 8.9 |
| TkA04G199610 | PF30319 | HI_0233 | 52 | 74 | 0.067 | 14.1 |
| TkA04G199610 | PF25977 | DZIP1 | 52 | 87 | 0.63 | 11.0 |
| TkA04G199610 | PF05524 | PEP-utilisers_N | 52 | 136 | 0.67 | 10.9 |
| TkA04G199610 | PF10392 | COG5_N | 58 | 132 | 0.2 | 12.6 |
| TkA04G199610 | PF26552 | DUF8181 | 63 | 97 | 0.017 | 16.3 |
| TkA04G199610 | PF28337 | NNF2_middle | 66 | 87 | 0.27 | 11.6 |
| TkA04G199610 | PF26552 | DUF8181 | 104 | 137 | 0.017 | 16.3 |
| TkA04G199610 | PF28337 | NNF2_middle | 105 | 129 | 0.27 | 11.6 |
| TkA04G199610 | PF14942 | Muted | 106 | 122 | 0.027 | 15.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.