TkA04G149390 | RubberDandelionOmics

Gene overview

TkA04G149390

Reference: TK1151 Chr: Chr04 Coordinates: 38676730-38678130 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

771 bp · TkA04G149390|TK1151|cDNA

TTCTCCCCCCTTATAACCTCTTATTCCCCTCTAACAGAAATATTAGTTTCATTCGTTTCACCATATTTCCTGGATCTCTCTCCCCTGTCTTCCTCCTTCAGCCATTCTGCTCTTCACGTAATCCTCAAGTTTCCACTAGCAATCATGGCGAACGCCGCTTCTGGTATGGCTGTGCATGATGAATGCAAGCTCAAGTTTCTGGAATTAAAATCGAAGAGGACCTTCCGATACATCACCTACAAAATCGAAGATCAACAGGT...

CDS

Download CDS FASTA

558 bp · TkA04G149390|TK1151|CDS

TTCTCCCCCCTTATAACCTCTTATTCCCCTCTAACAGAAATATTAGTTTCATTCGTTTCACCATATTTCCTGGATCTCTCTCCCCTGTCTTCCTCCTTCAGCCATTCTGCTCTTCACGTAATCCTCAAGTTTCCACTAGCAATCATGGCGAACGCCGCTTCTGGTATGGCTGTGCATGATGAATGCAAGCTCAAGTTTCTGGAATTAAAATCGAAGAGGACCTTCCGATACATCACCTACAAAATCGAAGATCAACAGGT...

Protein

Download Protein FASTA

185 aa · TkA04G149390|TK1151|PROTEIN

FSPLITSYSPLTEILVSFVSPYFLDLSPLSSSFSHSALHVILKFPLAIMANAASGMAVHDECKLKFLELKSKRTFRYITYKIEDQQVTIDKIGGSEESYEDFTNSLPADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRMKMVYASSKDRFKRELDGIQLELQATDPSEMSFDIIKSRAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G149390`
TK1151 ID	TkA04G149390
OH-1004 ID	LXL04_035247
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.872 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G149390

Location Chr04:38676730-38678130 (-)

Description Similar to ADF7: Actin-depolymerizing factor 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25590`	Actin-depolymerizing protein.	Arabidopsis actin-depolymerizing factor7 severs actin filaments and regulates actin cable turnover to promote normal pollen tube growth.2013 · DOI: 10.1105/tpc.113.117820
`At5g52360`	Actin-depolymerizing protein.	No verified direct reference in this release
`At3g46000`	Actin-depolymerizing protein.	Actin-depolymerizing factor2-mediated actin dynamics are essential for root-knot nematode infection of Arabidopsis.2009 · DOI: 10.1105/tpc.109.069104

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0555700`	Actin-depolymerizing protein.	No verified direct reference in this release
`Os02g0663800`	Actin-depolymerizing protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035247 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0030042 actin filament depolymerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005884 actin filament Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

GO:0048046 apoplast Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT3G46000

ath:AT4G25590

ath:AT5G52360

dosa:Os02g0663800

dosa:Os04g0555700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.733

Rank 1 · TkA04G149390 · TK1151

Nucleus0.422

Rank 2 · TkA04G149390 · TK1151

Endoplasmic reticulum0.054

Rank 3 · TkA04G149390 · TK1151

Cell membrane0.050

Rank 4 · TkA04G149390 · TK1151

Mitochondrion0.049

Rank 5 · TkA04G149390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00241Cofilin_ADF55-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G149390	`PF00241`	Cofilin_ADF	55	183	1.4e-41	142.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67ZM4`	Arabidopsis thaliana	sp\|Q67ZM4\|ADF7_ARATH Actin-depolymerizing factor 7	82.500%	Swiss-Prot	High
`Q8LFH6`	Arabidopsis thaliana	sp\|Q8LFH6\|ADF12_ARATH Actin-depolymerizing factor 12	78.800%	Swiss-Prot	High
`Q39251`	Arabidopsis thaliana	sp\|Q39251\|ADF2_ARATH Actin-depolymerizing factor 2	77.000%	Swiss-Prot	High
`Q7XSN9`	Oryza sativa subsp. japonica	sp\|Q7XSN9\|ADF6_ORYSJ Actin-depolymerizing factor 6	77.700%	Swiss-Prot	High
`Q6EUH7`	Oryza sativa subsp. japonica	sp\|Q6EUH7\|ADF1_ORYSJ Actin-depolymerizing factor 1	77.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card