TkA04G148770 | RubberDandelionOmics

Gene overview

TkA04G148770

Reference: TK1151 Chr: Chr04 Coordinates: 38536565-38537342 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

708 bp · TkA04G148770|TK1151|cDNA

GGCAAATGCTGCATCAGGGATGGCTGTGCATGATGACTGCAAGCTAAAATTCCTGGAACTGAAGGCAAAAAGAACCTTCCGTTATATAATCTTCAAGATCGAAGAGAAGCAAAAGGAAGTGGTTGTTGAGAGAGTTGGTGAGCCAACCGAAAACCACGACGATTTTGCTGCTTCACTATCCGATAACGAGTGCCGATATGCTGTCTTTGACTATGACTTTGTAACAGCAGAAAACTGCCAAAAAAGCAGGATCTTTTTCA...

CDS

Download CDS FASTA

399 bp · TkA04G148770|TK1151|CDS

ATGGCTGTGCATGATGACTGCAAGCTAAAATTCCTGGAACTGAAGGCAAAAAGAACCTTCCGTTATATAATCTTCAAGATCGAAGAGAAGCAAAAGGAAGTGGTTGTTGAGAGAGTTGGTGAGCCAACCGAAAACCACGACGATTTTGCTGCTTCACTATCCGATAACGAGTGCCGATATGCTGTCTTTGACTATGACTTTGTAACAGCAGAAAACTGCCAAAAAAGCAGGATCTTTTTCATCGCCTGGTCGCCTGACAC...

Protein

Download Protein FASTA

132 aa · TkA04G148770|TK1151|PROTEIN

MAVHDDCKLKFLELKAKRTFRYIIFKIEEKQKEVVVERVGEPTENHDDFAASLSDNECRYAVFDYDFVTAENCQKSRIFFIAWSPDTARVRTKMIYASSKDRFKRELDGIQMELQATDPTEMDLEVFKSRAN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G148770`
TK1151 ID	TkA04G148770
OH-1004 ID	LXL04_007847
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.600
Protein coverage (%)	TK1151 98.485 / OH-1004 22.184 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G148770

Location Chr04:38536565-38537342 (-)

Description Similar to ADF1: Actin-depolymerizing factor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46010`	Actin-depolymerizing protein.	ADF proteins are involved in the control of flowering and regulate F-actin organization, cell expansion, and organ growth in Arabidopsis.2001 · DOI: 10.1105/tpc.13.6.1333 Arabidopsis actin-depolymerizing factors (ADFs) 1 and 9 display antagonist activities.2011 · DOI: 10.1016/j.febslet.2011.05.019
`At5g59890`	Actin-depolymerizing protein.	Arabidopsis actin-depolymerizing factor AtADF4 mediates defense signal transduction triggered by the Pseudomonas syringae effector AvrPphB.2009 · DOI: 10.1104/pp.109.137604 Arabidopsis actin depolymerizing factor4 modulates the stochastic dynamic behavior of actin filaments in the cortical array of epidermal cells.2011 · DOI: 10.1105/tpc.111.090670 Arabidopsis Actin-Depolymerizing Factor-4 links pathogen perception, defense activation and transcription to cytoskeletal dynamics.2012 · DOI: 10.1371/journal.ppat.1003006 ACTIN DEPOLYMERIZING FACTOR4 regulates actin dynamics during innate immune signaling in Arabidopsis.2014 · DOI: 10.1105/tpc.113.122499

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0113400`	Actin-depolymerizing protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007847 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0007015 actin filament organization Biological Process

GO:0030042 actin filament depolymerization Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

KEGG gene cross-reference

ath:AT3G46010

ath:AT5G59880

ath:AT5G59890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.821

Rank 1 · TkA04G148770 · TK1151

Nucleus0.226

Rank 2 · TkA04G148770 · TK1151

Cell membrane0.107

Rank 3 · TkA04G148770 · TK1151

Golgi apparatus0.038

Rank 4 · TkA04G148770 · TK1151

Mitochondrion0.036

Rank 5 · TkA04G148770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00241Cofilin_ADF2-131 aa

PF06932DUF128356-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G148770	`PF00241`	Cofilin_ADF	2	131	3.8e-40	137.3
TkA04G148770	`PF06932`	DUF1283	56	90	0.16	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39250`	Arabidopsis thaliana	sp\|Q39250\|ADF1_ARATH Actin-depolymerizing factor 1	78.000%	Swiss-Prot	High
`Q9ZSK3`	Arabidopsis thaliana	sp\|Q9ZSK3\|ADF4_ARATH Actin-depolymerizing factor 4	78.800%	Swiss-Prot	High
`Q0DLA3`	Oryza sativa subsp. japonica	sp\|Q0DLA3\|ADF7_ORYSJ Actin-depolymerizing factor 7	80.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card