TkA04G126200 | RubberDandelionOmics

Gene overview

TkA04G126200

Reference: TK1151 Chr: Chr04 Coordinates: 32781303-32784008 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1418 bp · TkA04G126200|TK1151|cDNA

CAAACAGCCCCTAAGTATCACTCAGACTCCATACACGAGCCCTAGCTGTCTCACCTCGCTCTGCTATCGCCGATCGTTCCTTTGTTGTCGCCGGCAAGCCCTCGATCGCTCTGTGTTTACTTATTTCTTCTCCACACAACCCGTCGATCACACTTCTGTTCTGATTTTCTTCTTCAATGGAGACGCAAGCAGGTCGAACGGAGCAATATGCTGGTAACAACACCGGCAACGACAAGATACGATTTACGAAACACACGACG...

CDS

Download CDS FASTA

639 bp · TkA04G126200|TK1151|CDS

ATGTTCGGTCGTAGAGGCTTTGGCAAAGATCCAACAGTAGAAACTAGTTTTTTACCTGACAGTGAGAGAGAGGCAGAGGAGCAAGCTGAACGTGAAAGGTTGCGAAAACAATGGCTTCGTGAGCAAGAACAAATCAAAAATGAGGCACTTGAAATCACTTACAGTTACTGGGATGGTGCGGGCCATAGAAGAGTCATGCAGGTTAGAAAAGGGGATACAATTGGGGAGTTTTTACGGTCTGTTCAGCAACAACTTACAAC...

Protein

Download Protein FASTA

212 aa · TkA04G126200|TK1151|PROTEIN

MFGRRGFGKDPTVETSFLPDSEREAEEQAERERLRKQWLREQEQIKNEALEITYSYWDGAGHRRVMQVRKGDTIGEFLRSVQQQLTTSDRKVDNKNGTEVVYVKEDLIIPHLSEASCEEDNTRSNSSQSGQKQPYPPQLSWKLIKTNMFLHPNRKNQTIDEIMVCHCKPSYDGRMECQDECLNRMLNTECVKGTCPCGDFCSNQQVIYISKF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G126200`
TK1151 ID	TkA04G126200
OH-1004 ID	LXL04_004634
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.300
Protein coverage (%)	TK1151 96.698 / OH-1004 61.224 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G126200

Location Chr04:32781303-32784008 (-)

Description Similar to XCT: Protein XAP5 CIRCADIAN TIMEKEEPER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21150`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release
`At1g77300`	Histone methyltransferase involved in di and tri-methylation of 'Lys-36' of histone H3 (H3K36me2 and H3K36me3).	Prevention of early flowering by expression of FLOWERING LOCUS C requires methylation of histone H3 K36.2005 · DOI: 10.1038/ncb1329 Di- and tri- but not monomethylation on histone H3 lysine 36 marks active transcription of genes involved in flowering time regulation and other processes in Arabidopsis thaliana.2008 · DOI: 10.1128/mcb.01607-07 The ASH1 HOMOLOG 2 (ASHH2) histone H3 methyltransferase is required for ovule and anther development in Arabidopsis.2009 · DOI: 10.1371/journal.pone.0007817 Autoimmunity in Arabidopsis acd11 is mediated by epigenetic regulation of an immune receptor.2010 · DOI: 10.1371/journal.ppat.1001137 Histone lysine methyltransferase SDG8 is involved in brassinosteroid-regulated gene expression in Arabidopsis thaliana.2014 · DOI: 10.1093/mp/ssu056

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BDW1`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release
`Os09g0535300`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004634 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009637 response to blue light Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010114 response to red light Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0010363 regulation of plant-type hypersensitive response Biological Process

GO:0016116 carotenoid metabolic process Biological Process

KEGG gene cross-reference

ath:AT1G77300

ath:AT2G21150

dosa:Os09g0535300

dpo:4801527

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.495

Rank 1 · TkA04G126200 · TK1151

Cytoplasm0.437

Rank 2 · TkA04G126200 · TK1151

Mitochondrion0.085

Rank 3 · TkA04G126200 · TK1151

Cell membrane0.082

Rank 4 · TkA04G126200 · TK1151

Extracellular0.050

Rank 5 · TkA04G126200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04921XAP549-113 aa

PF17907AWS177-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G126200	`PF04921`	XAP5	49	113	1.7e-12	48.7
TkA04G126200	`PF17907`	AWS	177	205	6.5e-11	42.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H110`	Arabidopsis thaliana	sp\|Q8H110\|XCT_ARATH Protein XAP5 CIRCADIAN TIMEKEEPER	76.900%	Swiss-Prot	Low
`Q2LAE1`	Arabidopsis thaliana	sp\|Q2LAE1\|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2	76.900%	Swiss-Prot	Low
`B8BDW1`	Oryza sativa subsp. indica	sp\|B8BDW1\|XCT_ORYSI Protein XAP5 CIRCADIAN TIMEKEEPER	76.900%	Swiss-Prot	Low
`Q69JZ7`	Oryza sativa subsp. japonica	sp\|Q69JZ7\|XCT_ORYSJ Protein XAP5 CIRCADIAN TIMEKEEPER	76.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card