TkA04G084220 | RubberDandelionOmics

Gene overview

TkA04G084220

Reference: TK1151 Chr: Chr04 Coordinates: 22070286-22072316 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1310 bp · TkA04G084220|TK1151|cDNA

AAAAGACGAAAACCATAACGTGGCGAGAAGAGAGGAGCTTCGTGATGTTTACTGTTTGCTGACACTGAAAACAATGAGCTACGTGTTACATCTTCCTTCATTTCATCATCCACTTGTTCTTCGGTTCCTGTATGAATAAAGCAAGAAATCGGGAGGGAAAATGCTTACTTACAGGTTTATTGAATAATCGATGGCTCAATCAACATTGAGAGCAAAGGAAGATGTACAGTCGTTTGTGTGTTGAGTGGACACCGAATTCC...

CDS

Download CDS FASTA

921 bp · TkA04G084220|TK1151|CDS

ATGTACAGTCGTTTGTGTGTTGAGTGGACACCGAATTCCCGCCGTTGGATTAGGGACATGGAGATCGGGTTCCAAGCTTCCGATTCCGTCGCCACCGCTATTGTCGAGGCTGGTTATCGACACATTGATACGGCATGGGAGTATGGCGTTCACGAAGAGGTAGGCCATGGTCTAAAGGCAGCCATGGATGCAGGAATCGAGAGGAAGGATCTCTTCGTCACATCCAAGTTATGGTGCCATGATTTATCCCCAGAAAAGGT...

Protein

Download Protein FASTA

306 aa · TkA04G084220|TK1151|PROTEIN

MYSRLCVEWTPNSRRWIRDMEIGFQASDSVATAIVEAGYRHIDTAWEYGVHEEVGHGLKAAMDAGIERKDLFVTSKLWCHDLSPEKVRPALLNTLQELQLDYLDLYLIHWPFRLKEGPKAGDVLNFDMEGVWREMEKLVTQNLVRDIGISNFTLKKLNKLTGFAQTMPSVCQMEMHPGWRKDKMLEACKNNGIHVTAYSPLGSQDNGRDLIHEPTVDKIAKKLNKSPGQVLVRWAIQRGTSVIPKSTNPGRIKENMQVFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G084220`
TK1151 ID	TkA04G084220
OH-1004 ID	LXL04_036017
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 92.810 / OH-1004 89.720 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G084220

Location Chr04:22070286-22072316 (+)

Description Similar to Aldose reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37770`	Oxidoreductase acting on a broad range of substrates: reduces ketosteroids, aromatic aldehydes, ketones, sugars and other aliphatic aldehydes, and oxidizes hydroxysteroids.	Characterization of two novel aldo-keto reductases from Arabidopsis: expression patterns, broad substrate specificity, and an open active-site structure suggest a role in toxicant metabolism following stress.2009 · DOI: 10.1016/j.jmb.2009.07.023 NADPH-dependent reductases involved in the detoxification of reactive carbonyls in plants.2011 · DOI: 10.1074/jbc.m110.202226
`At3g53880`	Oxidoreductase that may act on a broad range of substrates such as ketosteroids, aldehydes, ketones and sugars.	No verified direct reference in this release
`At2g37760`	Oxidoreductase acting on a broad range of substrates: reduces ketosteroids, aromatic aldehydes, ketones, sugars and other aliphatic aldehydes, and oxidizes hydroxysteroids.	Characterization of two novel aldo-keto reductases from Arabidopsis: expression patterns, broad substrate specificity, and an open active-site structure suggest a role in toxicant metabolism following stress.2009 · DOI: 10.1016/j.jmb.2009.07.023
`At2g37790`	Oxidoreductase that may act on a broad range of substrates such as ketosteroids, aldehydes, ketones and sugars.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036017 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004032 aldose reductase (NADPH) activity Molecular Function

GO:0008106 alcohol dehydrogenase (NADP+) activity Molecular Function

GO:0016229 steroid dehydrogenase activity Molecular Function

GO:0070401 NADP+ binding Molecular Function

KEGG gene cross-reference

ath:AT2G37760

ath:AT2G37770

ath:AT2G37790

ath:AT3G53880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.613

Rank 1 · TkA04G084220 · TK1151

Nucleus0.276

Rank 2 · TkA04G084220 · TK1151

Peroxisome0.114

Rank 3 · TkA04G084220 · TK1151

Mitochondrion0.101

Rank 4 · TkA04G084220 · TK1151

Plastid0.092

Rank 5 · TkA04G084220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07524Bromo_TP29-41 aa

PF00248Aldo_ket_red30-274 aa

PF04539Sigma70_r381-96 aa

PF07524Bromo_TP86-103 aa

PF07524Bromo_TP135-166 aa

PF04539Sigma70_r3211-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G084220	`PF07524`	Bromo_TP	29	41	0.35	11.6
TkA04G084220	`PF00248`	Aldo_ket_red	30	274	9.9e-46	156.8
TkA04G084220	`PF04539`	Sigma70_r3	81	96	0.079	13.8
TkA04G084220	`PF07524`	Bromo_TP	86	103	0.35	11.6
TkA04G084220	`PF07524`	Bromo_TP	135	166	0.35	11.6
TkA04G084220	`PF04539`	Sigma70_r3	211	231	0.079	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0PGJ6`	Arabidopsis thaliana	sp\|Q0PGJ6\|AKRC9_ARATH NADPH-dependent aldo-keto reductase, chloroplastic	47.000%	Swiss-Prot	Medium
`Q9M338`	Arabidopsis thaliana	sp\|Q9M338\|AKRCB_ARATH Aldo-keto reductase family 4 member C11	44.900%	Swiss-Prot	Medium
`O80944`	Arabidopsis thaliana	sp\|O80944\|AKRC8_ARATH Aldo-keto reductase family 4 member C8	42.900%	Swiss-Prot	Medium
`Q84TF0`	Arabidopsis thaliana	sp\|Q84TF0\|AKRCA_ARATH Aldo-keto reductase family 4 member C10	43.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card