TkA04G022020 | RubberDandelionOmics

Gene overview

TkA04G022020

Reference: TK1151 Chr: Chr04 Coordinates: 5586821-5593381 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2034 bp · TkA04G022020|TK1151|cDNA

ATGGGATTGCTCTTCCTCCTCCTCCTCATAATATCCCTCTTTTCATCTTCCACATCAAAAGAGGAAGAAGTCAACGCTCTACTCAAATGGAAAACCAACCTCATAAACCAAAACAATCCTATGCTTTCTTCATGGTCATCTCTCCTTCACCAAAACACCACCGCTGCACCATGCACATGGTATGGTGTTCGTTGCGATAATCATGGAAATGTAAAAGAACTAAACCTTTCGTCTTCAAGGTTAAATGGTACACTTGACCA...

CDS

Download CDS FASTA

2034 bp · TkA04G022020|TK1151|CDS

ATGGGATTGCTCTTCCTCCTCCTCCTCATAATATCCCTCTTTTCATCTTCCACATCAAAAGAGGAAGAAGTCAACGCTCTACTCAAATGGAAAACCAACCTCATAAACCAAAACAATCCTATGCTTTCTTCATGGTCATCTCTCCTTCACCAAAACACCACCGCTGCACCATGCACATGGTATGGTGTTCGTTGCGATAATCATGGAAATGTAAAAGAACTAAACCTTTCGTCTTCAAGGTTAAATGGTACACTTGACCA...

Protein

Download Protein FASTA

677 aa · TkA04G022020|TK1151|PROTEIN

MGLLFLLLLIISLFSSSTSKEEEVNALLKWKTNLINQNNPMLSSWSSLLHQNTTAAPCTWYGVRCDNHGNVKELNLSSSRLNGTLDHFTFSCFTSLTHLNLKTNDISGGIPRNIRYLSKLIFLDLSGNRFSGIIPLDIGFLTSLKTLGLNQNQFTGSIPASLGNLTNLVDFRADDNRLSGYIPQELGNLVNLVNVNISFNFQKGPIPSTLGNMINLSTLYLYQNNLSGPIPPSLGNLTSLTFLVVYMNELSGRIPTELGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G022020`
TK1151 ID	TkA04G022020
OH-1004 ID	LXL04_039612
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 20.384 / OH-1004 13.623 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G022020

Location Chr04:5586821-5593381 (-)

Description Similar to TSB: Tryptophan synthase beta chain 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56040`	Receptor with a serine/threonine-protein kinase activity (By similarity).	A novel pollen-pistil interaction conferring high-temperature tolerance during reproduction via CLE45 signaling.2013 · DOI: 10.1016/j.cub.2013.06.060 RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63 Arabidopsis MAKR5 is a positive effector of BAM3-dependent CLE45 signaling.2016 · DOI: 10.15252/embr.201642450

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039612 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004834 tryptophan synthase activity Molecular Function

GO:0019904 protein domain specific binding Molecular Function

KEGG gene cross-reference

ath:AT4G27070

ath:AT5G54810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.760

Rank 1 · TkA04G022020 · TK1151

Endoplasmic reticulum0.107

Rank 2 · TkA04G022020 · TK1151

Nucleus0.096

Rank 3 · TkA04G022020 · TK1151

Cytoplasm0.089

Rank 4 · TkA04G022020 · TK1151

Extracellular0.030

Rank 5 · TkA04G022020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_222-66 aa

PF00560LRR_170-86 aa

PF13855LRR_870-130 aa

PF12799LRR_470-107 aa

PF25013LRR_Zer-170-128 aa

PF29594LRR_SKP270-127 aa

PF23598LRR_1490-199 aa

PF00560LRR_195-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G022020	`PF08263`	LRRNT_2	22	66	7.1e-10	39.7
TkA04G022020	`PF00560`	LRR_1	70	86	7.2e-39	124.1
TkA04G022020	`PF13855`	LRR_8	70	130	2.8e-32	111.0
TkA04G022020	`PF12799`	LRR_4	70	107	1.1e-25	89.8
TkA04G022020	`PF25013`	LRR_Zer-1	70	128	0.013	16.3
TkA04G022020	`PF29594`	LRR_SKP2	70	127	0.19	11.7
TkA04G022020	`PF23598`	LRR_14	90	199	3.3e-28	99.2
TkA04G022020	`PF00560`	LRR_1	95	117	7.2e-39	124.1
TkA04G022020	`PF29252`	LRR_NLRC4	110	129	0.0046	17.0
TkA04G022020	`PF00560`	LRR_1	119	141	7.2e-39	124.1
TkA04G022020	`PF12799`	LRR_4	119	155	1.1e-25	89.8
TkA04G022020	`PF13855`	LRR_8	141	178	2.8e-32	111.0
TkA04G022020	`PF29252`	LRR_NLRC4	141	176	0.0046	17.0
TkA04G022020	`PF00560`	LRR_1	143	165	7.2e-39	124.1
TkA04G022020	`PF23286`	LRR_13	156	198	0.00033	21.1
TkA04G022020	`PF12799`	LRR_4	166	203	1.1e-25	89.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K6B8`	Arabidopsis thaliana	sp\|F4K6B8\|RGI4_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4	34.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card