TkA04G020960 | RubberDandelionOmics

Gene overview

TkA04G020960

Reference: TK1151 Chr: Chr04 Coordinates: 5333025-5333575 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA04G020960|TK1151|cDNA

ATGTCACTTGTTGTTCAACATACTCATTACATGCCTAAAAGATGGCGGGAAAAAGAGAGAACCGAATTTGTTAGAGTGGAGTTTGAAACCCTTTTTCAGTACACGAGAAAGATGTTGTTGGAGGAAATGACTTCCATCTTTTTAACTACCAAATGTGATCTATCTATACTTGAACGGGTTGATGATATTTTGCAATTCATCGCGGATTTCACGGTTGATGTTCAAGGCGTTGGTGATGTTTGCAGCTTTAGTACTTCTGA...

CDS

Download CDS FASTA

324 bp · TkA04G020960|TK1151|CDS

ATGTCACTTGTTGTTCAACATACTCATTACATGCCTAAAAGATGGCGGGAAAAAGAGAGAACCGAATTTGTTAGAGTGGAGTTTGAAACCCTTTTTCAGTACACGAGAAAGATGTTGTTGGAGGAAATGACTTCCATCTTTTTAACTACCAAATGTGATCTATCTATACTTGAACGGGTTGATGATATTTTGCAATTCATCGCGGATTTCACGGTTGATGTTCAAGGCGTTGGTGATGTTTGCAGCTTTAGTACTTCTGA...

Protein

Download Protein FASTA

107 aa · TkA04G020960|TK1151|PROTEIN

MSLVVQHTHYMPKRWREKERTEFVRVEFETLFQYTRKMLLEEMTSIFLTTKCDLSILERVDDILQFIADFTVDVQGVGDVCSFSTSDFQKHGNINYASPHNSSRKSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G020960`
TK1151 ID	TkA04G020960
OH-1004 ID	LXL04_036888
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.100
Protein coverage (%)	TK1151 100.000 / OH-1004 12.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G020960

Location Chr04:5333025-5333575 (-)

Description Similar to ATG9: Autophagy-related protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31260`	Phospholipid scramblase involved in autophagy by mediating autophagosomal membrane expansion.	Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene.2002 · DOI: 10.1104/pp.011024 A revised assay for monitoring autophagic flux in Arabidopsis thaliana reveals involvement of AUTOPHAGY-RELATED9 in autophagy.2014 · DOI: 10.14348/molcells.2014.0042

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036888 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000423 mitophagy Biological Process

GO:0006869 lipid transport Biological Process

GO:0006907 pinocytosis Biological Process

GO:0006909 phagocytosis Biological Process

GO:0006914 autophagy Biological Process

GO:0009408 response to heat Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0019954 asexual reproduction Biological Process

GO:0034497 protein localization to phagophore assembly site Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

KEGG gene cross-reference

ath:AT2G31260

cnb:CNBD0770

ddi:DDB_G0285323

uma:UMAG_04380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.448

Rank 1 · TkA04G020960 · TK1151

Nucleus0.417

Rank 2 · TkA04G020960 · TK1151

Mitochondrion0.162

Rank 3 · TkA04G020960 · TK1151

Cell membrane0.077

Rank 4 · TkA04G020960 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA04G020960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04109ATG91-85 aa

PF04130GCP_C_terminal26-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G020960	`PF04109`	ATG9	1	85	4.8e-24	85.9
TkA04G020960	`PF04130`	GCP_C_terminal	26	78	0.091	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RUS5`	Arabidopsis thaliana	sp\|Q8RUS5\|ATG9_ARATH Autophagy-related protein 9	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card