TkA04G017930 | RubberDandelionOmics

Gene overview

TkA04G017930

Reference: TK1151 Chr: Chr04 Coordinates: 4492324-4498811 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5144 bp · TkA04G017930|TK1151|cDNA

TAAATCCTACCCTAATTTAGCTCCGATTTTTCATACGATTGATCCCCGGAACCTTCTCCACCTCCTTCATCCTTTTCACAATCGATTCACAATTTTCCATTCCCTAATATGATCACGTGAAGCGCTTAATTTGGTGTTCGATTTCACATTCAATTGGACCCTAGAATCTGATGATCTGATTTGAGGCAAGTTTTGCTCTTGAGATAAAAGAGCAAATTGTAAAGCCAATGATTATATATATACACCAAAATTTAAAGGTT...

CDS

Download CDS FASTA

3675 bp · TkA04G017930|TK1151|CDS

ATGATTATATATATACACCAAAATTTAAAGGTTAAAGCTTACGAGATGTTAGCAATGGCTGCCACCAAGGGATTAATCGATCACTTGCTATTGGCCGCCTGCGAGTGGTTTTTAATGTTTTGGGTGTTCATCGATGCGGCATTGGCTTATTCCCTTACAAAATTCGCTCGCTACTGTGATTTACAAATTCCATGTTTATTATGCTCACGACTTGACCATTTCTTTGATAAAGAAGAACCCGGATCTTATTTCCATTTATT...

Protein

Download Protein FASTA

1224 aa · TkA04G017930|TK1151|PROTEIN

MIIYIHQNLKVKAYEMLAMAATKGLIDHLLLAACEWFLMFWVFIDAALAYSLTKFARYCDLQIPCLLCSRLDHFFDKEEPGSYFHLFCNNHQADISYLIYCNLHNELVDIREICEDCLHSQSNLECYRFVGEKNLPCMGSSIRTCSCCKRQWKEKPSGQTMIDPQMSRGCNLTTKPPLPRTSVGMGRRVRPRHGDGVRRVRNKTRNRRKYALSHGSYSDANMTSDSEFEFLFSDDDDGLWRRSLIQNHPMMRGTINGTSH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G017930`
TK1151 ID	TkA04G017930
OH-1004 ID	LXL04_036905
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 98.366 / OH-1004 80.106 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G017930

Location Chr04:4492324-4498811 (+)

Description Similar to MYOB4: Probable myosin-binding protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30690`	Membrane-anchored myosin receptors that define a distinct, plant-specific transport vesicle compartment.	No verified direct reference in this release
`At1g74830`	Probable membrane-anchored myosin receptors.	No verified direct reference in this release
`At1g18990`	Probable membrane-anchored myosin receptors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036905 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0030133 transport vesicle Cellular Component

GO:0017022 myosin binding Molecular Function

GO:0080115 myosin XI tail binding Molecular Function

KEGG gene cross-reference

ath:AT1G08800

ath:AT2G30690

ath:AT5G16720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.526

Rank 1 · TkA04G017930 · TK1151

Nucleus0.369

Rank 2 · TkA04G017930 · TK1151

Cell membrane0.135

Rank 3 · TkA04G017930 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA04G017930 · TK1151

Mitochondrion0.046

Rank 5 · TkA04G017930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29869YGL117W334-358 aa

PF29869YGL117W437-464 aa

PF29869YGL117W615-648 aa

PF29869YGL117W710-746 aa

PF29869YGL117W820-850 aa

PF29869YGL117W925-946 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G017930	`PF29869`	YGL117W	334	358	0.34	11.5
TkA04G017930	`PF29869`	YGL117W	437	464	0.34	11.5
TkA04G017930	`PF29869`	YGL117W	615	648	0.34	11.5
TkA04G017930	`PF29869`	YGL117W	710	746	0.34	11.5
TkA04G017930	`PF29869`	YGL117W	820	850	0.34	11.5
TkA04G017930	`PF29869`	YGL117W	925	946	0.34	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4INW9`	Arabidopsis thaliana	sp\|F4INW9\|MYOB4_ARATH Probable myosin-binding protein 4	37.500%	Swiss-Prot	Low
`F4HVS6`	Arabidopsis thaliana	sp\|F4HVS6\|MYOB6_ARATH Probable myosin-binding protein 6	37.100%	Swiss-Prot	Low
`Q9LMC8`	Arabidopsis thaliana	sp\|Q9LMC8\|MYOB5_ARATH Probable myosin-binding protein 5	41.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card