TkA04G010230 | RubberDandelionOmics

Gene overview

TkA04G010230

Reference: TK1151 Chr: Chr04 Coordinates: 2436653-2442188 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2241 bp · TkA04G010230|TK1151|cDNA

AACCACCTCACCAACCATAACCCCACCACCAAATTATACCCCTGGGTCTAAACGGCAAGTGATTAAAAGTTAAAACCAATGAAATTTTGGCGTGAAGTAAAAATTTTATTGTATCTAATTGACAGCTCAACCGTCAAAAGAAGGAAGAAAGAAGGAACGGCGGGGCAGGTCACCGGTGAGGCAGGAGACCTCGGCGCAGGTATAGCTGGGGCGGTGTGCCCAAAGGGGCCGTTGAGCCACCTCGGCACTGACTCCCTGCA...

CDS

Download CDS FASTA

1344 bp · TkA04G010230|TK1151|CDS

ATGAAGCAAGAAGGCATGAGTAATAATGTACCATCGTATGGGTTGCCTTCAAAGATTCTATGCAAGGTTGTACGTGTTGATTTAAAGGCAGAAGTTGGCACTGATGAAGTGTTTGCAGAGATTACTTTGCTTCCAAATTGTTCAGAAGGTGAGGGACCAAAGTTGACAAGTGTAGTTTCAGAAAAGAAACATGCAACTTTTTTCAGAAAGAGATTAACTCCTTCAGATGTCATCAAACAAGGAGGATGCAGCCTACACAA...

Protein

Download Protein FASTA

447 aa · TkA04G010230|TK1151|PROTEIN

MKQEGMSNNVPSYGLPSKILCKVVRVDLKAEVGTDEVFAEITLLPNCSEGEGPKLTSVVSEKKHATFFRKRLTPSDVIKQGGCSLHKRHVDQTFPPLDMKQDAPYQDLIAKDLHGQIWKFRHICRGLPKRHILTTGWSKFVSEKRLLPNDICIFLRGKNQLYVGVQRAVRGYKLPTELSTNNMKHGILLTAFEAFKTRTEFTVYYHPRISPSGFVVTYDDFMESLEANFSPKSRVEMVLDGGGGEEPELNLKKFSGFITG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G010230`
TK1151 ID	TkA04G010230
OH-1004 ID	LXL04_031971
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	32.800
Protein coverage (%)	TK1151 97.539 / OH-1004 80.027 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G010230

Location Chr04:2436653-2442188 (+)

Description Similar to ARF2B: Auxin response factor 2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62000`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	AUXIN RESPONSE FACTOR 2 (ARF2): a pleiotropic developmental regulator.2005 · DOI: 10.1111/j.1365-313x.2005.02426.x AUXIN RESPONSE FACTOR1 and AUXIN RESPONSE FACTOR2 regulate senescence and floral organ abscission in Arabidopsis thaliana.2005 · DOI: 10.1242/dev.02012 The AUXIN RESPONSE FACTOR 2 gene of Arabidopsis links auxin signalling, cell division, and the size of seeds and other organs.2006 · DOI: 10.1242/dev.02194

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2ZET6`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`Os11g0523800`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031971 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008219 cell death Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009836 fruit ripening, climacteric Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0010150 leaf senescence Biological Process

KEGG gene cross-reference

ath:AT1G59750

ath:AT5G62000

dosa:Os01g0927600

sly:778240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.954

Rank 1 · TkA04G010230 · TK1151

Cytoplasm0.094

Rank 2 · TkA04G010230 · TK1151

Cell membrane0.026

Rank 3 · TkA04G010230 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA04G010230 · TK1151

Plastid0.013

Rank 5 · TkA04G010230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B368-167 aa

PF25313BRWD_AD197-302 aa

PF06507ARF_AD214-302 aa

PF02362B3220-253 aa

PF02362B3313-329 aa

PF02309AUX_IAA345-391 aa

PF02309AUX_IAA398-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G010230	`PF02362`	B3	68	167	5.9e-17	62.2
TkA04G010230	`PF25313`	BRWD_AD	197	302	7.1e-07	30.1
TkA04G010230	`PF06507`	ARF_AD	214	302	3e-18	66.2
TkA04G010230	`PF02362`	B3	220	253	5.9e-17	62.2
TkA04G010230	`PF02362`	B3	313	329	5.9e-17	62.2
TkA04G010230	`PF02309`	AUX_IAA	345	391	4.2e-06	27.4
TkA04G010230	`PF02309`	AUX_IAA	398	440	4.2e-06	27.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JM3`	Arabidopsis thaliana	sp\|Q94JM3\|ARFB_ARATH Auxin response factor 2	49.200%	Swiss-Prot	Medium
`A2ZET6`	Oryza sativa subsp. indica	sp\|A2ZET6\|ARFW_ORYSI Auxin response factor 23	48.700%	Swiss-Prot	Medium
`Q2R3F5`	Oryza sativa subsp. japonica	sp\|Q2R3F5\|ARFW_ORYSJ Auxin response factor 23	48.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card