TkA03G605460 | RubberDandelionOmics

Gene overview

TkA03G605460

Reference: TK1151 Chr: Chr03 Coordinates: 153786648-153791827 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3285 bp · TkA03G605460|TK1151|cDNA

TAAACATCTTACTTGTATAAAAAACCATTTTTATATTTCCGTTACATAGGAACCATTTCTTTAACGTCGCTATTACACACAGCCCAGCCCAGCCCATTTATCTGATAATGCTATTACACAAAACAATGTAAAAAAAATCTGTAAAACTCAAGATTTGAAACCGAGCTTATTGTGTCATGTTAGAACTTAGAAGGCTTCAGCATCTTAAGAGTCTCTTCTCCAAGTTTTCTTTTGTATTATTTTGCTGCACATAGAAATTT...

CDS

Download CDS FASTA

2310 bp · TkA03G605460|TK1151|CDS

ATGGTTTCAACTTCGGAGAAAGCGACGCCTCTTGTCACGTCATCCTCTGCCGCCGATGTCGTCCAGGATTGGACCTCTGATCCCTCCGTCGGCGATCAGATTCGCCACCGCGGCACAGCTACTTCTGTCGGTAACTTGATTGGTCCCGTGGTTACTCAAACTTCCGCTGCTACTGCTGCTGCTAAAGGAACTGGTCCAACGAGTTCGGTGAGGATGCAGAGTCGCCATCCACTCGATCCTCTAGCTGCTGCTGAAATCTC...

Protein

Download Protein FASTA

769 aa · TkA03G605460|TK1151|PROTEIN

MVSTSEKATPLVTSSSAADVVQDWTSDPSVGDQIRHRGTATSVGNLIGPVVTQTSAATAAAKGTGPTSSVRMQSRHPLDPLAAAEISIAVATVRAAGATPEVRDSMRFIEVVLVEPSKTVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPRQARLIVYNKKSNETSIWIVELSEVHALTRGGHHRGKVISSKVVPDVQPPMDAVEYAECEAIVKDFPPFREAMKRRGIEDMDLVMVDPWCVGYHSEADAPNRRLAKPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G605460`
TK1151 ID	TkA03G605460
OH-1004 ID	LXL04_011612
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G605460`
Location	Chr03:153786648-153791827 (-)
Description	Similar to maoII: Copper methylamine oxidase (Arthrobacter sp. (strain P1)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011612` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002237 response to molecule of bacterial origin Biological Process GO:0009308 amine metabolic process Biological Process GO:0009447 putrescine catabolic process Biological Process GO:0009611 response to wounding Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0010311 lateral root formation Biological Process GO:0005777 peroxisome Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0005507 copper ion binding Molecular Function
KEGG gene cross-reference	ath:AT2G42490 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.417

Rank 1 · TkA03G605460 · TK1151

Cytoplasm0.241

Rank 2 · TkA03G605460 · TK1151

Endoplasmic reticulum0.134

Rank 3 · TkA03G605460 · TK1151

Mitochondrion0.122

Rank 4 · TkA03G605460 · TK1151

Nucleus0.092

Rank 5 · TkA03G605460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02727Cu_amine_oxidN276-165 aa

PF21994AGAO-like_N283-123 aa

PF02728Cu_amine_oxidN3207-315 aa

PF21994AGAO-like_N2304-324 aa

PF01179Cu_amine_oxid341-745 aa

PF07812TfuA506-588 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G605460	`PF02727`	Cu_amine_oxidN2	76	165	0.00024	22.0
TkA03G605460	`PF21994`	AGAO-like_N2	83	123	0.5	11.3
TkA03G605460	`PF02728`	Cu_amine_oxidN3	207	315	4.6e-28	98.2
TkA03G605460	`PF21994`	AGAO-like_N2	304	324	0.5	11.3
TkA03G605460	`PF01179`	Cu_amine_oxid	341	745	4.4e-150	500.7
TkA03G605460	`PF07812`	TfuA	506	588	0.25	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card