RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G593440
Reference: TK1151 Chr: Chr03 Coordinates: 150688667-150690188 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

988 bp · TkA03G593440|TK1151|cDNA

TTGATACCTTCGGCATTGGAGATGACCTCAACATACTTGTGAAAGCCCACAAAAGAATCAGTAGTTAAAAACCGAAATGTCGTGCTGAGGTCATGACTTTCACTGGAATGGCCTTCTTCTCTAATGATTTCATGCCACAAACCTCTCATAAAGATGACCTTCACTCTCCGATTTTCCAAACTTGTACTACCAGTCACGACTTCCATGGAATAGCCTCGTTATTGGGGAAAAGATCAATGTCGTATGCAACAGAGCTATTT...

CDS

Download CDS FASTA

855 bp · TkA03G593440|TK1151|CDS

ATGACTTTCACTGGAATGGCCTTCTTCTCTAATGATTTCATGCCACAAACCTCTCATAAAGATGACCTTCACTCTCCGATTTTCCAAACTTGTACTACCAGTCACGACTTCCATGGAATAGCCTCGTTATTGGGGAAAAGATCAATGTCGTATGCAACAGAGCTATTTGATCAAGAAACTAACACCTGCGAAGACGAATTATTGGACGATGGATTACTTGAAGGCGAGAAAAAGAGAAGATCGCTAAAATTGGAACAAGT...

Protein

Download Protein FASTA

284 aa · TkA03G593440|TK1151|PROTEIN

MTFTGMAFFSNDFMPQTSHKDDLHSPIFQTCTTSHDFHGIASLLGKRSMSYATELFDQETNTCEDELLDDGLLEGEKKRRSLKLEQVKTLERNFELGSKLDPERKMQLARELELQPRQVAIWFQNRRARWKTKQLEKDYDVLKSQFEAVKAQNDSLLSQNHKLHAQIMAIKNKDSSINLKVKETEGSCSNRIENSSEMIAHDHHHYQRNPNLLPPSIVDRSHQLFHNLSASTSADRHHQHHHYHLHGQKINQLVAMKEEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G593440
TK1151 IDTkA03G593440
OH-1004 IDLXL04_011489
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G593440
LocationChr03:150688667-150690188 (+)
DescriptionSimilar to ATHB-13: Homeobox-leucine zipper protein ATHB-13
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g69780 Probable transcription factor that may act in the sucrose-signaling pathway. No verified direct reference in this release
At1g26960 Probable transcription factor. No verified direct reference in this release
At5g15150 Probable transcription factor. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XD08 Probable transcription factor. No verified direct reference in this release
Os03g0170600 Probable transcription factor. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011489 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009733 response to auxin Biological Process
GO:0009739 response to gibberellin Biological Process
GO:0009744 response to sucrose Biological Process
GO:0009965 leaf morphogenesis Biological Process
GO:0010311 lateral root formation Biological Process
GO:0022622 root system development Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0048364 root development Biological Process
GO:0048527 lateral root development Biological Process
GO:0048768 root hair cell tip growth Biological Process
GO:0048826 cotyledon morphogenesis Biological Process
KEGG gene cross-reference
ath:AT1G26960
ath:AT1G69780
ath:AT3G01220
dosa:Os03g0170600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982
Rank 1 · TkA03G593440 · TK1151
Cytoplasm0.074
Rank 2 · TkA03G593440 · TK1151
Cell membrane0.021
Rank 3 · TkA03G593440 · TK1151
Endoplasmic reticulum0.013
Rank 4 · TkA03G593440 · TK1151
Plastid0.010
Rank 5 · TkA03G593440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046Homeodomain77-131 aa
PF28743IPGAL2_N81-98 aa
PF19962EAD986-95 aa
PF05920Homeobox_KN102-129 aa
PF29075NOCA1_mid124-189 aa
PF19962EAD9128-155 aa
PF02183HALZ133-173 aa
PF21037CCDC138_cc133-173 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G593440PF00046Homeodomain771315.2e-1762.1
TkA03G593440PF28743IPGAL2_N81981.49.4
TkA03G593440PF19962EAD986950.1812.3
TkA03G593440PF05920Homeobox_KN1021290.0002121.8
TkA03G593440PF29075NOCA1_mid1241890.02815.0
TkA03G593440PF19962EAD91281550.1812.3
TkA03G593440PF02183HALZ1331731.7e-1557.6
TkA03G593440PF21037CCDC138_cc1331730.1612.8
TkA03G593440PF28743IPGAL2_N1331641.49.4
TkA03G593440PF18035Bap31_Bap29_C1341640.08313.7
TkA03G593440PF24079UBR41542320.03915.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8LC03Arabidopsis thalianasp|Q8LC03|ATB13_ARATH Homeobox-leucine zipper protein ATHB-1351.400%Swiss-ProtHigh
Q8LFD3Arabidopsis thalianasp|Q8LFD3|ATB23_ARATH Homeobox-leucine zipper protein ATHB-2347.300%Swiss-ProtMedium
Q00466Arabidopsis thalianasp|Q00466|HAT7_ARATH Homeobox-leucine zipper protein HAT742.200%Swiss-ProtMedium
A2XD08Oryza sativa subsp. indicasp|A2XD08|HOX21_ORYSI Homeobox-leucine zipper protein HOX2154.600%Swiss-ProtMedium
Q8S7W9Oryza sativa subsp. japonicasp|Q8S7W9|HOX21_ORYSJ Homeobox-leucine zipper protein HOX2154.600%Swiss-ProtMedium

JBrowse

View in Genome Browser