TkA03G585870 | RubberDandelionOmics

Gene overview

TkA03G585870

Reference: TK1151 Chr: Chr03 Coordinates: 148807579-148809608 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

955 bp · TkA03G585870|TK1151|cDNA

TAGCAGGCTCCACTTTCCTTGAAATTGGGCCTCCATTATAAAAGCCCCTACACCCTTCTTTTGGATTCTACAACTTCCATCCTTGACAGTTCATACAACTTTTCTCTTTACAGGTACATTGTTCTGCAATCACTATATACGCATTTCAGAAGTGATAATTAAGAAAAGCATCAATCCAGACATGGCCGAGTTTAAAGCAATCGAGAGTGATCAAAACGTGTTACAGAAACACGTTGCATTCTTTGATCGTAACAACGATG...

CDS

Download CDS FASTA

585 bp · TkA03G585870|TK1151|CDS

ATGGCCGAGTTTAAAGCAATCGAGAGTGATCAAAACGTGTTACAGAAACACGTTGCATTCTTTGATCGTAACAACGATGGTGTGATTTACCCTTGGGAAACTTTTCAAGGGTTTCGAGCAATTGGGAGTGGGATTACGTTATCGGCATTTGCCGCCGTCTTCATCCATATGGGACTTAGTGGCAAAACTCGTCCAGGAAAGAAGTTTCCTAATTTACTTTTCCCAATCGAGATAAAAAACATAACTATGGCCAAACATGG...

Protein

Download Protein FASTA

194 aa · TkA03G585870|TK1151|PROTEIN

MAEFKAIESDQNVLQKHVAFFDRNNDGVIYPWETFQGFRAIGSGITLSAFAAVFIHMGLSGKTRPGKKFPNLLFPIEIKNITMAKHGSDSGVYDTHGRFVSSKFEEIFHKYAHTNSDALTSDELDNFIKGNREPKDYGGWIGGLSEWKILYFLGKDKNGLLKKETIKGVYDGSLFEKMAEEKIRNSSKKKQIDK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G585870`
TK1151 ID	TkA03G585870
OH-1004 ID	LXL04_011384
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.700
Protein coverage (%)	TK1151 95.876 / OH-1004 45.700 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G585870

Location Chr03:148807579-148809608 (-)

Description Similar to PXG4: Probable peroxygenase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70670`	Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies.	No verified direct reference in this release
`At1g70680`	Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies.	No verified direct reference in this release
`At1g23240`	Probable calcium-binding peroxygenase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011384 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009819 drought recovery Biological Process

GO:0005811 lipid droplet Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:1990137 plant seed peroxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G70670

ath:AT1G70680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.456

Rank 1 · TkA03G585870 · TK1151

Mitochondrion0.202

Rank 2 · TkA03G585870 · TK1151

Cytoplasm0.197

Rank 3 · TkA03G585870 · TK1151

Cell membrane0.119

Rank 4 · TkA03G585870 · TK1151

Nucleus0.106

Rank 5 · TkA03G585870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05042Caleosin10-179 aa

PF13405EF-hand_620-42 aa

PF13405EF-hand_6104-129 aa

PF01023S_100106-129 aa

PF13405EF-hand_6155-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G585870	`PF05042`	Caleosin	10	179	9.8e-72	241.1
TkA03G585870	`PF13405`	EF-hand_6	20	42	6.3e-05	23.1
TkA03G585870	`PF13405`	EF-hand_6	104	129	6.3e-05	23.1
TkA03G585870	`PF01023`	S_100	106	129	0.039	14.3
TkA03G585870	`PF13405`	EF-hand_6	155	167	6.3e-05	23.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAB7`	Arabidopsis thaliana	sp\|Q9CAB7\|PXG4_ARATH Probable peroxygenase 4	62.700%	Swiss-Prot	High
`Q9CAB8`	Arabidopsis thaliana	sp\|Q9CAB8\|PXG5_ARATH Probable peroxygenase 5	63.200%	Swiss-Prot	High
`B3H7A9`	Arabidopsis thaliana	sp\|B3H7A9\|PXG7_ARATH Probable peroxygenase 7	54.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card