TkA03G581950 | RubberDandelionOmics

Gene overview

TkA03G581950

Reference: TK1151 Chr: Chr03 Coordinates: 147738534-147741674 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2263 bp · TkA03G581950|TK1151|cDNA

ATAAAGGGTAAAATAGGGTTTCCCAGCAACACCGGAGTTTCTATCTTCACCGATACTCACCCGCCTTTTTACCTTCACCGCCATTCCTTTCGATCGAACCCCATGTGCCACTCGTCTCTCTCTCTAGATCTCTCTTTGAGATCGACTGTATATATACATGTGTATGTATAGTTTAGCTTCGAAGATACCAGCAGACAGGAACGTGAGCTTAAAGTTCATCATGTGCTACTAGTTTTCTACTCTATAATCAATACCAAACT...

CDS

Download CDS FASTA

1671 bp · TkA03G581950|TK1151|CDS

ATGGAGAAAAATCCCCTTTTCTCATTCTGCTTATGCATCTTCATTTTCAGCTTCCTAAGCTGTGATTCAGCTCTCCCTTCAGACCAAAACGATCAAATCAGTTCTATCTTAGGCGAAAATGGGGACGATAACTTGGGCCATTGGAGAAACGGGATCATAAGCTCATCAGCTGAAGCTCCTGGTCCTTCAAGTGGACCACCTGGTGCACTTGTACTAGCGGGTTCAAGAACAAAAAGGCCTGATGTTCTTAACCGATTCAG...

Protein

Download Protein FASTA

556 aa · TkA03G581950|TK1151|PROTEIN

MEKNPLFSFCLCIFIFSFLSCDSALPSDQNDQISSILGENGDDNLGHWRNGIISSSAEAPGPSSGPPGALVLAGSRTKRPDVLNRFRKYQGGWDITNKHYWASVGFTGAVALILAILWFMSFGVAIITHHFCGWRINIKGKESKLSQTLCFILLIIFTIAAATGCILLSVGQDEFHGEAVDTLNYVVNQSDYTVQTLVNVTGYLSLAKSVNVAQFYLPEDVKDSIDKLNVDLNSASDTLGSKTHQNSRKIRTVVDAVRSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G581950`
TK1151 ID	TkA03G581950
OH-1004 ID	LXL04_011319
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G581950`
Location	Chr03:147738534-147741674 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011319` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.532

Rank 1 · TkA03G581950 · TK1151

Lysosome / Vacuole0.274

Rank 2 · TkA03G581950 · TK1151

Cytoplasm0.147

Rank 3 · TkA03G581950 · TK1151

Endoplasmic reticulum0.099

Rank 4 · TkA03G581950 · TK1151

Golgi apparatus0.065

Rank 5 · TkA03G581950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00335Tetraspanin7-21 aa

PF00689Cation_ATPase_C69-163 aa

PF04906Tweety84-365 aa

PF20990DUF2207_C93-166 aa

PF20237DUF659495-164 aa

PF03706LPG_synthase_TM106-171 aa

PF09799Transmemb_17111-169 aa

PF10754DUF2569113-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G581950	`PF00335`	Tetraspanin	7	21	0.056	13.8
TkA03G581950	`PF00689`	Cation_ATPase_C	69	163	0.03	14.8
TkA03G581950	`PF04906`	Tweety	84	365	0.00095	18.7
TkA03G581950	`PF20990`	DUF2207_C	93	166	0.023	15.1
TkA03G581950	`PF20237`	DUF6594	95	164	0.00029	21.6
TkA03G581950	`PF03706`	LPG_synthase_TM	106	171	0.4	10.8
TkA03G581950	`PF09799`	Transmemb_17	111	169	0.037	15.3
TkA03G581950	`PF10754`	DUF2569	113	165	0.23	12.6
TkA03G581950	`PF00335`	Tetraspanin	118	190	0.056	13.8
TkA03G581950	`PF29293`	DUF8530	142	168	2.0	9.3
TkA03G581950	`PF29008`	DDB_G0292058_C	152	436	1.6e-05	24.7
TkA03G581950	`PF20990`	DUF2207_C	228	308	0.023	15.1
TkA03G581950	`PF20237`	DUF6594	243	303	0.00029	21.6
TkA03G581950	`PF00335`	Tetraspanin	245	329	0.056	13.8
TkA03G581950	`PF03706`	LPG_synthase_TM	251	324	0.4	10.8
TkA03G581950	`PF10754`	DUF2569	253	291	0.23	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card