TkA03G581780 | RubberDandelionOmics

Gene overview

TkA03G581780

Reference: TK1151 Chr: Chr03 Coordinates: 147690551-147693726 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3086 bp · TkA03G581780|TK1151|cDNA

CTTAGGAGACCAGTTTTGAAAGAATCCACAAATTTAGTGGTCAAATTATAAAAACATCAATTTAAAGAAGTAATTGGGCAAGCAAGGGGGTGAAGCACTCTAACCAGCCGCCGTCCACTAGAGCTGGTGGCAATGGATGAATCTACGTCGATCGATTCCTCCTCTTCTGTTCTACCATGTGCAAGATTTTTCAAACCCCTAAACTTGCTTCGATTTAGCAGCAATTTGTAACTTTTGTTCATCATATCACATGAATATCT...

CDS

Download CDS FASTA

2241 bp · TkA03G581780|TK1151|CDS

ATGACCCTCCATGTTAGATCTTCAAAATCCATCGTCTCCACTGGAAAAAACAGCTTTAATGTCATAAAGGTTCGTTTAACATTTTTATCGAAATCTTTTCATCAATCTCAGAACAACCCATTTGCCAAAACCAATAGCCATAACTGTACAAATACGAGTATCGATTGCTCCGAGTTTCATTTCAAAAACCTAATATTTGCAGCGATTGAAAGAAATTCTTGGGCATTTTGCTACAATACTAAGCGGAGTCCTAACCCTCT...

Protein

Download Protein FASTA

746 aa · TkA03G581780|TK1151|PROTEIN

MTLHVRSSKSIVSTGKNSFNVIKVRLTFLSKSFHQSQNNPFAKTNSHNCTNTSIDCSEFHFKNLIFAAIERNSWAFCYNTKRSPNPLQYKFQAVIFEPELFTRVLNSIREHPRIALRFFHWVEKQPGFTPSDNSFVAILVILAERNLMNRAYPVMENLACRNLHGVVDSLIDGNLNANIAIKLLDFMLFFLTKKLMVEQCIWVFNKMIESKLLPDVKNCNRILKMLRDTKSAHRRRKVYSMMIENDIKPNIITYNTLLDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G581780`
TK1151 ID	TkA03G581780
OH-1004 ID	LXL04_011311
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G581780

Location Chr03:147690551-147693726 (-)

Description Similar to At1g22960: Pentatricopeptide repeat-containing protein At1g22960, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22960`	Pentatricopeptide repeat-containing protein At1g22960, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011311 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0090615 mitochondrial mRNA processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0036002 pre-mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G22960

ath:AT2G02150

ath:AT5G39710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.779

Rank 1 · TkA03G581780 · TK1151

Plastid0.120

Rank 2 · TkA03G581780 · TK1151

Nucleus0.054

Rank 3 · TkA03G581780 · TK1151

Cytoplasm0.031

Rank 4 · TkA03G581780 · TK1151

Cell membrane0.011

Rank 5 · TkA03G581780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23276TPR_2451-71 aa

PF08579RPM294-110 aa

PF13041PPR_2112-137 aa

PF29070MSC6_N125-156 aa

PF17177PPR_long128-161 aa

PF12854PPR_1180-187 aa

PF13041PPR_2190-217 aa

PF01535PPR191-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G581780	`PF23276`	TPR_24	51	71	1.6e-27	96.8
TkA03G581780	`PF08579`	RPM2	94	110	0.34	12.1
TkA03G581780	`PF13041`	PPR_2	112	137	7e-146	475.0
TkA03G581780	`PF29070`	MSC6_N	125	156	9e-20	71.8
TkA03G581780	`PF17177`	PPR_long	128	161	1.2e-36	126.8
TkA03G581780	`PF12854`	PPR_1	180	187	1.1e-109	358.6
TkA03G581780	`PF13041`	PPR_2	190	217	7e-146	475.0
TkA03G581780	`PF01535`	PPR	191	211	2.3e-91	294.6
TkA03G581780	`PF17177`	PPR_long	196	292	1.2e-36	126.8
TkA03G581780	`PF23276`	TPR_24	197	232	1.6e-27	96.8
TkA03G581780	`PF13812`	PPR_3	203	262	9.5e-73	240.9
TkA03G581780	`PF24760`	TPR_IF140_C	205	247	0.13	13.4
TkA03G581780	`PF13041`	PPR_2	214	263	7e-146	475.0
TkA03G581780	`PF29070`	MSC6_N	220	310	9e-20	71.8
TkA03G581780	`PF23276`	TPR_24	237	306	1.6e-27	96.8
TkA03G581780	`PF08579`	RPM2	237	262	0.34	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C7Q9`	Arabidopsis thaliana	sp\|P0C7Q9\|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial	40.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card