TkA03G570770 | RubberDandelionOmics

Gene overview

TkA03G570770

Reference: TK1151 Chr: Chr03 Coordinates: 144792863-144796742 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1421 bp · TkA03G570770|TK1151|cDNA

CTCATTTGAACTCACGAGTGCTTAAACTCAAGCACTCTCATCTATTTGTGAGTAGTTAAGCTCTTTCATTAGAGTTTAAAAAAAATAGAAAAATAGATGGTGAAGTTCACTAAGCAGTTTGAGGGTCAGTTAGTCCCTGAATGGAAAGACGCATTCGTTGATTATTGGCAACTCAAGAAAGATATTAAGAAAATCAATTTTGATTCTAATATTTCCACCACTCTTTCATCAAAACCCAAACATAAAAGCTCATTAACCAG...

CDS

Download CDS FASTA

522 bp · TkA03G570770|TK1151|CDS

ATGGTGAAGTTCACTAAGCAGTTTGAGGGTCAGTTAGTCCCTGAATGGAAAGACGCATTCGTTGATTATTGGCAACTCAAGAAAGATATTAAGAAAATCAATTTTGATTCTAATATTTCCACCACTCTTTCATCAAAACCCAAACATAAAAGCTCATTAACCAGCACCTTCTTCTCTTCATTACACAAACTTTCCTTATTTGGAAATCAGTGTAGATCCCATGAAGTCATTCACGTTCACAGTAAGCTTCAATCGACATT...

Protein

Download Protein FASTA

173 aa · TkA03G570770|TK1151|PROTEIN

MVKFTKQFEGQLVPEWKDAFVDYWQLKKDIKKINFDSNISTTLSSKPKHKSSLTSTFFSSLHKLSLFGNQCRSHEVIHVHSKLQSTLSKGVLYQTELLEKFADTEAATDFFALLDLQLNKVNEFYRKKEKEFLDRGECLEKQLHILIELKNAIKDQQKKNKLIHPIATPRMRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G570770`
TK1151 ID	TkA03G570770
OH-1004 ID	LXL04_011179
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 91.329 / OH-1004 18.588 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G570770

Location Chr03:144792863-144796742 (+)

Description Similar to PHO1-1: Phosphate transporter PHO1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68740`	Contributes to the loading of inorganic phosphate (Pi) into the root xylem vessels.	No verified direct reference in this release
`At3g23430`	Inositol polyphosphate sensor that associates with transcription factors to regulate inorganic phosphate (Pi) starvation responses.	Identification and characterization of the Arabidopsis PHO1 gene involved in phosphate loading to the xylem.2002 · DOI: 10.1105/tpc.000745 Members of the PHO1 gene family show limited functional redundancy in phosphate transfer to the shoot, and are regulated by phosphate deficiency via distinct pathways.2007 · DOI: 10.1111/j.1365-313x.2007.03108.x Over-expression of PHO1 in Arabidopsis leaves reveals its role in mediating phosphate efflux.2011 · DOI: 10.1111/j.1365-313x.2011.04532.x Functional expression of PHO1 to the Golgi and trans-Golgi network and its role in export of inorganic phosphate.2012 · DOI: 10.1111/j.1365-313x.2012.05004.x PHO1 expression in guard cells mediates the stomatal response to abscisic acid in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.05058.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0493600`	May transport inorganic phosphate (Pi).	No verified direct reference in this release
`Os01g0110100`	May transport inorganic phosphate (Pi).	No verified direct reference in this release
`Os02g0809800`	Involved in the transfer of inorganic phosphate (Pi) from roots to shoots.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011179 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006817 phosphate ion transport Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000822 inositol hexakisphosphate binding Molecular Function

GO:0005315 phosphate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G68740

dosa:Os06g0493600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.436

Rank 1 · TkA03G570770 · TK1151

Nucleus0.393

Rank 2 · TkA03G570770 · TK1151

Cell membrane0.191

Rank 3 · TkA03G570770 · TK1151

Lysosome / Vacuole0.088

Rank 4 · TkA03G570770 · TK1151

Endoplasmic reticulum0.087

Rank 5 · TkA03G570770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03105SPX2-160 aa

PF29874Wac95-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G570770	`PF03105`	SPX	2	160	6.4e-34	119.2
TkA03G570770	`PF29874`	Wac	95	163	2e-05	25.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZF5`	Arabidopsis thaliana	sp\|Q93ZF5\|PHO11_ARATH Phosphate transporter PHO1 homolog 1	63.100%	Swiss-Prot	High
`Q8S403`	Arabidopsis thaliana	sp\|Q8S403\|PHO1_ARATH Phosphate transporter PHO1	41.800%	Swiss-Prot	Medium
`Q651J5`	Oryza sativa subsp. japonica	sp\|Q651J5\|PHO13_ORYSJ Phosphate transporter PHO1-3	46.800%	Swiss-Prot	Medium
`Q657S5`	Oryza sativa subsp. japonica	sp\|Q657S5\|PHO11_ORYSJ Phosphate transporter PHO1-1	45.000%	Swiss-Prot	Medium
`Q6K991`	Oryza sativa subsp. japonica	sp\|Q6K991\|PHO12_ORYSJ Phosphate transporter PHO1-2	27.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card