TkA03G569220 | RubberDandelionOmics

Gene overview

TkA03G569220

Reference: TK1151 Chr: Chr03 Coordinates: 144367773-144368914 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

876 bp · TkA03G569220|TK1151|cDNA

CTCACCTTTTCATTACATGAAAAACTGAAAATTGAAAGCGCACCATAATCCTCTACGCCTCCTCCATAATCGACAGCGATGGCGTCGTCTTCATCGAAGGTGAAGGTAATAAAACAGGCCATAAAAGAATCGATGGAAGAGGTCAGAGGCGGTACGAACTCCTCATCCGATGACGGCGCCGATGCTGAAGATAACAAACACCACCGCCTCCTATCCAAATTGATGTCTCAGTTGGAGAAATTAGAGGCTGAGCCGGAATT...

CDS

Download CDS FASTA

609 bp · TkA03G569220|TK1151|CDS

ATGGCGTCGTCTTCATCGAAGGTGAAGGTAATAAAACAGGCCATAAAAGAATCGATGGAAGAGGTCAGAGGCGGTACGAACTCCTCATCCGATGACGGCGCCGATGCTGAAGATAACAAACACCACCGCCTCCTATCCAAATTGATGTCTCAGTTGGAGAAATTAGAGGCTGAGCCGGAATTCAACACAGAGGAATTAGTCGACGATGAGAAAACCAAAACGAAGATAAAGAAGTCGTCGAAATCGGAAGAAGATGAAGA...

Protein

Download Protein FASTA

202 aa · TkA03G569220|TK1151|PROTEIN

MASSSSKVKVIKQAIKESMEEVRGGTNSSSDDGADAEDNKHHRLLSKLMSQLEKLEAEPEFNTEELVDDEKTKTKIKKSSKSEEDEEEKIVKELKKVKKQNLITHCLLSAMIVLTVAWQISEVSIILKVKDGVNHPFRSVGNIFKWMIPPPKANGDEEETNSSTTHNLIESSRTGDLKIPELLPHVELPKTRLGFPFLKNEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G569220`
TK1151 ID	TkA03G569220
OH-1004 ID	LXL04_011154
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G569220`
Location	Chr03:144367773-144368914 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011154` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.356

Rank 1 · TkA03G569220 · TK1151

Nucleus0.243

Rank 2 · TkA03G569220 · TK1151

Plastid0.205

Rank 3 · TkA03G569220 · TK1151

Cytoplasm0.135

Rank 4 · TkA03G569220 · TK1151

Cell membrane0.101

Rank 5 · TkA03G569220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30077Iron_transporter6-24 aa

PF16046FAM7612-100 aa

PF13086AAA_1115-115 aa

PF04698Rab_eff_C19-111 aa

PF04889Cwf_Cwc_1521-100 aa

PF29026DUF4350_C38-106 aa

PF14914LRRC37AB_C43-116 aa

PF11712Vma1245-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G569220	`PF30077`	Iron_transporter	6	24	0.0036	16.1
TkA03G569220	`PF16046`	FAM76	12	100	7.6	6.6
TkA03G569220	`PF13086`	AAA_11	15	115	1.5	9.3
TkA03G569220	`PF04698`	Rab_eff_C	19	111	4.1	6.3
TkA03G569220	`PF04889`	Cwf_Cwc_15	21	100	0.52	10.8
TkA03G569220	`PF29026`	DUF4350_C	38	106	0.16	12.9
TkA03G569220	`PF14914`	LRRC37AB_C	43	116	0.071	13.8
TkA03G569220	`PF11712`	Vma12	45	127	0.0027	18.4
TkA03G569220	`PF30077`	Iron_transporter	74	139	0.0036	16.1
TkA03G569220	`PF16944`	KCH	74	127	0.0085	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card