TkA03G561400 | RubberDandelionOmics

Gene overview

TkA03G561400

Reference: TK1151 Chr: Chr03 Coordinates: 142436300-142439439 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1410 bp · TkA03G561400|TK1151|cDNA

GATAGATATTAAAAAAAAAACAAAATAAGGAAAAGGTCAGACGCTATATTTACGCATCCCAATGTCGGCACCTATTTCATCATCAACATTAACTTCACCTTCAACAAAACCAAGAGCCAAGCAACCTCCCGGAGTTTAGCTCCGGCAATCGCAATCCACACGCCACAAAGAGCGACATCGTCAATCTCCGATCGATGGCGCTCCGGACAGCAATCACCAGACGAATCCTGAGCTCGAGCTCGGCCGTACATGGCTCGCGA...

CDS

Download CDS FASTA

1278 bp · TkA03G561400|TK1151|CDS

ATGGCGCTCCGGACAGCAATCACCAGACGAATCCTGAGCTCGAGCTCGGCCGTACATGGCTCGCGATCCATGTCTGCGTGGTGGAAAAATGTTGAGCCTGCGCCGAAAGATCCCATTCTTGGTGTGACTGAAGCTTTTCTCGCAGATCCTAGTCCTGATAAAGTTAATGTTGGCGTTGGAGCTTATCGTGATGATAACGGGAAGCCGGTGGTTCTCGATTGTGTTAGAGAAGCAGAGAGACGGATTGCTGGAAACATGAA...

Protein

Download Protein FASTA

425 aa · TkA03G561400|TK1151|PROTEIN

MALRTAITRRILSSSSAVHGSRSMSAWWKNVEPAPKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLDCVREAERRIAGNMNMEYLPMGGSNLMVEETLKLAYGEDSDLIKDKRIAAVQALSGTGACRLFADFQKRFSPDSHIYIPVPTWSNHHNIWRDANVPQRTFHYYHPDTKGLDFASLMDDVKNAPKGSFFLLHACAHNPTGVDPTEEQWKEMSYQFKVKGHFAFFDMAYQGFASGDPEKDVKSIRIFLED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G561400`
TK1151 ID	TkA03G561400
OH-1004 ID	LXL04_011035
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G561400

Location Chr03:142436300-142439439 (+)

Description Similar to ASP1: Aspartate aminotransferase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30970`	Amino acid aminotransferase important for the metabolism of amino acids and Krebs-cycle related organic acids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011035 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006103 2-oxoglutarate metabolic process Biological Process

GO:0006107 oxaloacetate metabolic process Biological Process

GO:0006520 amino acid metabolic process Biological Process

GO:0006531 aspartate metabolic process Biological Process

GO:0006532 L-aspartate biosynthetic process Biological Process

GO:0006533 L-aspartate catabolic process Biological Process

GO:0006536 glutamate metabolic process Biological Process

GO:0006538 L-glutamate catabolic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0014850 response to muscle activity Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0019550 L-glutamate catabolic process to aspartate Biological Process

KEGG gene cross-reference

ath:AT2G30970

ddi:DDB_G0268664

mcf:101867025

rno:25721

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.938

Rank 1 · TkA03G561400 · TK1151

Cytoplasm0.081

Rank 2 · TkA03G561400 · TK1151

Nucleus0.052

Rank 3 · TkA03G561400 · TK1151

Cell membrane0.029

Rank 4 · TkA03G561400 · TK1151

Plastid0.016

Rank 5 · TkA03G561400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155Aminotran_1_253-418 aa

PF08417PaO128-160 aa

PF08417PaO347-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G561400	`PF00155`	Aminotran_1_2	53	418	1.5e-88	298.1
TkA03G561400	`PF08417`	PaO	128	160	0.27	12.1
TkA03G561400	`PF08417`	PaO	347	369	0.27	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46643`	Arabidopsis thaliana	sp\|P46643\|AAT1_ARATH Aspartate aminotransferase, mitochondrial	81.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card