TkA03G560040 | RubberDandelionOmics

Gene overview

TkA03G560040

Reference: TK1151 Chr: Chr03 Coordinates: 142025726-142029155 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2395 bp · TkA03G560040|TK1151|cDNA

TATTTCAACCCATACCCCCTTTCAGAAACCGCCCCGCCCATACGCAACCCGTTTCTCACTTCCGTAAAACTAACAACTCTTCGTCTTCTTGATACAAATCCCCAAATTTTCTGCCAATTCCTCTCTTTTCTTATCACCATGGATTCATCATCATCTTCATCAATGGATCGGGTCAACTTCAGGACACAAGTCCTAACGCGACATCTCAAAAACCACCATAACGCCGCCAGCGATCTCCTACACACCGTCCCATGTGTCAG...

CDS

Download CDS FASTA

2184 bp · TkA03G560040|TK1151|CDS

TATTTCAACCCATACCCCCTTTCAGAAACCGCCCCGCCCATACGCAACCCGTTTCTCACTTCCGTAAAACTAACAACTCTTCGTCTTCTTGATACAAATCCCCAAATTTTCTGCCAATTCCTCTCTTTTCTTATCACCATGGATTCATCATCATCTTCATCAATGGATCGGGTCAACTTCAGGACACAAGTCCTAACGCGACATCTCAAAAACCACCATAACGCCGCCAGCGATCTCCTACACACCGTCCCATGTGTCAG...

Protein

Download Protein FASTA

727 aa · TkA03G560040|TK1151|PROTEIN

YFNPYPLSETAPPIRNPFLTSVKLTTLRLLDTNPQIFCQFLSFLITMDSSSSSSMDRVNFRTQVLTRHLKNHHNAASDLLHTVPCVSYSPPELSEPPLNFDTKLLRKLLDGQNIAEIDYVFNLMMQSNLFCPRERGGKVFISPDFNQSMEQQREMTMRRIDYLREQGAFDGWFSKKGPEGELWRFALAESATVFDHSLGIKLGVHFFLWGGAIRFMGTKRHHDKWFKPTETYEVKGCFAMTELGHGSNVRGIETITRYDA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G560040`
TK1151 ID	TkA03G560040
OH-1004 ID	LXL04_011006
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 93.673 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G560040

Location Chr03:142025726-142029155 (+)

Description Similar to ACX3: Acyl-coenzyme A oxidase 3, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06290`	Catalyzes the desaturation of medium-chain acyl-CoAs to 2-trans-enoyl-CoAs.	No verified direct reference in this release
`At1g06310`	Catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs.	No verified direct reference in this release
`At5g65110`	Catalyzes the desaturation of long-chain acyl-CoAs to 2- trans-enoyl-CoAs.	Long-chain acyl-CoA oxidases of Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00559.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011006 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001676 long-chain fatty acid metabolic process Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process

GO:0051791 medium-chain fatty acid metabolic process Biological Process

GO:0055088 lipid homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009514 glyoxysome Cellular Component

GO:0003997 acyl-CoA oxidase activity Molecular Function

GO:0005504 fatty acid binding Molecular Function

KEGG gene cross-reference

ath:AT1G06290

ath:AT1G06310

ath:AT5G65110

mmu:74121

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.677

Rank 1 · TkA03G560040 · TK1151

Mitochondrion0.168

Rank 2 · TkA03G560040 · TK1151

Cytoplasm0.152

Rank 3 · TkA03G560040 · TK1151

Nucleus0.057

Rank 4 · TkA03G560040 · TK1151

Plastid0.051

Rank 5 · TkA03G560040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14749Acyl-CoA_ox_N145-234 aa

PF02770Acyl-CoA_dh_M237-345 aa

PF00441Acyl-CoA_dh_1379-535 aa

PF22924ACOX_C_alpha1384-535 aa

PF01756ACOX445-481 aa

PF01756ACOX581-711 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G560040	`PF14749`	Acyl-CoA_ox_N	145	234	0.019	16.2
TkA03G560040	`PF02770`	Acyl-CoA_dh_M	237	345	1.2e-10	42.1
TkA03G560040	`PF00441`	Acyl-CoA_dh_1	379	535	2.1e-09	38.4
TkA03G560040	`PF22924`	ACOX_C_alpha1	384	535	1.8e-41	142.5
TkA03G560040	`PF01756`	ACOX	445	481	1.2e-17	64.8
TkA03G560040	`PF01756`	ACOX	581	711	1.2e-17	64.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0CZ23`	Arabidopsis thaliana	sp\|P0CZ23\|ACOX3_ARATH Acyl-coenzyme A oxidase 3, peroxisomal	70.700%	Swiss-Prot	High
`Q9LMI7`	Arabidopsis thaliana	sp\|Q9LMI7\|ACO32_ARATH Putative acyl-coenzyme A oxidase 3.2, peroxisomal	69.400%	Swiss-Prot	High
`O65201`	Arabidopsis thaliana	sp\|O65201\|ACOX2_ARATH Acyl-coenzyme A oxidase 2, peroxisomal	37.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card