Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3048 bp · TkA03G558360|TK1151|cDNA
ATGCAACGGCTCTCGTTGTGGACTCGTCAACAGCATATCGAAGCTATCGATAGCGAGGCACGTGATATCAATCTCATTCTTGATCTTGTTGATTCCGAGCCTGCTCTAAACCTCAGGGCCGATGCCGTGGTCCTGTCCTGGATTCTTGGATCTGTATCTGAGAATCTTTATGCCAGTCACATCTTGTCCAAATCCTCCTCTGAAATCTGGACTGAACTAAAAGAGACATATGAAAAACTTGACGGATCTATTGTGTTTAA...
3048 bp · TkA03G558360|TK1151|CDS
ATGCAACGGCTCTCGTTGTGGACTCGTCAACAGCATATCGAAGCTATCGATAGCGAGGCACGTGATATCAATCTCATTCTTGATCTTGTTGATTCCGAGCCTGCTCTAAACCTCAGGGCCGATGCCGTGGTCCTGTCCTGGATTCTTGGATCTGTATCTGAGAATCTTTATGCCAGTCACATCTTGTCCAAATCCTCCTCTGAAATCTGGACTGAACTAAAAGAGACATATGAAAAACTTGACGGATCTATTGTGTTTAA...
Protein
Download Protein FASTA1015 aa · TkA03G558360|TK1151|PROTEIN
MQRLSLWTRQQHIEAIDSEARDINLILDLVDSEPALNLRADAVVLSWILGSVSENLYASHILSKSSSEIWTELKETYEKLDGSIVFNIYQRINMCVQGSDTLSDYYNKLNSLWKEFDALTDLDKCTCEAGKKSENHNQKIKLMQFLMGLDESFSNVRSNILMREPLPSVKSAFAICSREESYKSGTSFGSNSKNPNSVFFSKVNDNKKKFSNNNNRPPLVCKNCGVKGHTIERCFKLIGYPKDFKGKSESHFQNNKATAN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G558360 |
|---|---|
| TK1151 ID | TkA03G558360 |
| OH-1004 ID | LXL04_036249 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 55.000 |
| Protein coverage (%) | TK1151 93.103 / OH-1004 46.027Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G558360 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:141369955-141376470 (-) | |||||||||
| Description | Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006508 proteolysis Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0009909 regulation of flower development Biological Process GO:0015074 DNA integration Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003677 DNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G41710 dosa:Os05g0389000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14223Retrotran_gag_240-177 aaPF16988Vps36-NZF-N204-228 aaPF22936Pol_BBD326-402 aaPF13976gag_pre-integrs434-497 aaPF16988Vps36-NZF-N483-492 aaPF00665rve515-611 aaPF29688TnsB_C551-625 aaPF25597SH3_retrovirus685-743 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G558360 | PF14223 | Retrotran_gag_2 | 40 | 177 | 0.0001 | 22.9 |
| TkA03G558360 | PF16988 | Vps36-NZF-N | 204 | 228 | 0.079 | 13.1 |
| TkA03G558360 | PF22936 | Pol_BBD | 326 | 402 | 3.1e-08 | 34.6 |
| TkA03G558360 | PF13976 | gag_pre-integrs | 434 | 497 | 8.2e-08 | 32.6 |
| TkA03G558360 | PF16988 | Vps36-NZF-N | 483 | 492 | 0.079 | 13.1 |
| TkA03G558360 | PF00665 | rve | 515 | 611 | 3.4e-12 | 47.2 |
| TkA03G558360 | PF29688 | TnsB_C | 551 | 625 | 2.6e-05 | 24.8 |
| TkA03G558360 | PF25597 | SH3_retrovirus | 685 | 743 | 1.7e-17 | 63.6 |
| TkA03G558360 | PF07727 | RVT_2 | 947 | 990 | 1.5e-07 | 32.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.