Gene Card
Gene overview
cDNA / CDS / Protein Sequences
498 bp · TkA03G557390|TK1151|cDNA
ATGCCACGAACGCCGTCCCAACGCAGCCGTCTACCGGAAGAAAATGAAATCTCCATTTCGGAATCGCTCATTTCTTCGGAGTTTAAAGATATCCTTACATTTGATTCTCGTAAATCATCTTCACAGACGGATGATGCCCTAAATCTAAGGGTGAATATTCATGATTCTAGTGATCCCGTGAACACCTTTGCTTCTTGTTCGGATTCGAACGTGGGTTCCAATCCAATTCCTGTTATAGATCGAGATTTACAAATTCAAAT...
498 bp · TkA03G557390|TK1151|CDS
ATGCCACGAACGCCGTCCCAACGCAGCCGTCTACCGGAAGAAAATGAAATCTCCATTTCGGAATCGCTCATTTCTTCGGAGTTTAAAGATATCCTTACATTTGATTCTCGTAAATCATCTTCACAGACGGATGATGCCCTAAATCTAAGGGTGAATATTCATGATTCTAGTGATCCCGTGAACACCTTTGCTTCTTGTTCGGATTCGAACGTGGGTTCCAATCCAATTCCTGTTATAGATCGAGATTTACAAATTCAAAT...
Protein
Download Protein FASTA165 aa · TkA03G557390|TK1151|PROTEIN
MPRTPSQRSRLPEENEISISESLISSEFKDILTFDSRKSSSQTDDALNLRVNIHDSSDPVNTFASCSDSNVGSNPIPVIDRDLQIQIPHSWSVDPDYSRTNLRCSKTTINELEQPSNPKSQQLASSSIVRQWIVLFIMYLSLGVVIYCSRENVMDSETRVSVDAL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G557390 |
|---|---|
| TK1151 ID | TkA03G557390 |
| OH-1004 ID | LXL04_010948 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 93.220Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G557390 |
|---|---|
| Location | Chr03:141072489-141072986 (+) |
| Description | Protein of unknown function |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0010027 thylakoid membrane organization Biological Process GO:0010196 nonphotochemical quenching Biological Process GO:0071257 cellular response to electrical stimulus Biological Process GO:0071805 potassium ion transmembrane transport Biological Process GO:0097623 potassium ion export across plasma membrane Biological Process GO:1990573 potassium ion import across plasma membrane Biological Process GO:0005634 nucleus Cellular Component GO:0005773 vacuole Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009533 chloroplast stromal thylakoid Cellular Component GO:0009705 plant-type vacuole membrane Cellular Component GO:0034705 potassium channel complex Cellular Component |
| KEGG gene cross-reference | ath:AT4G18160 ath:AT5G46370 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.