TkA03G555680 | RubberDandelionOmics

Gene overview

TkA03G555680

Reference: TK1151 Chr: Chr03 Coordinates: 140664679-140665056 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

378 bp · TkA03G555680|TK1151|cDNA

ATGTGTTCAAATAAGGTTATGAGGTTGAATGATGTGAAGACGAATGATGATGGCCATAACTGTTGGTTCGATTGCTTCTTTGACAATCGGAGCTTCAATTTGGGCGGAATGGGGTGTAGCGCCGGTGTAATCGTCATCGATCTCGCTAAGGATATGTTACAGGTTTACCGGAGCTTCAACAAGACCTCGCCGGAAAAACCGGCGTCTCTTTATCAAAAGATCTTATGGCAATCGCTGGCGGTGCACCGAAAACCAACATC...

CDS

Download CDS FASTA

378 bp · TkA03G555680|TK1151|CDS

ATGTGTTCAAATAAGGTTATGAGGTTGAATGATGTGAAGACGAATGATGATGGCCATAACTGTTGGTTCGATTGCTTCTTTGACAATCGGAGCTTCAATTTGGGCGGAATGGGGTGTAGCGCCGGTGTAATCGTCATCGATCTCGCTAAGGATATGTTACAGGTTTACCGGAGCTTCAACAAGACCTCGCCGGAAAAACCGGCGTCTCTTTATCAAAAGATCTTATGGCAATCGCTGGCGGTGCACCGAAAACCAACATC...

Protein

Download Protein FASTA

125 aa · TkA03G555680|TK1151|PROTEIN

MCSNKVMRLNDVKTNDDGHNCWFDCFFDNRSFNLGGMGCSAGVIVIDLAKDMLQVYRSFNKTSPEKPASLYQKILWQSLAVHRKPTSQPYIPVIDELEAPEKACNLSLVLMAKTCTKLVFRSGFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G555680`
TK1151 ID	TkA03G555680
OH-1004 ID	LXL04_010923
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.600
Protein coverage (%)	TK1151 65.600 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G555680

Location Chr03:140664679-140665056 (+)

Description Similar to KCS9: 3-ketoacyl-CoA synthase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16280`	Involved in the elongation of C22 to C24 fatty acids, which are precursors for the biosynthesis of cuticular waxes, aliphatic suberins, and membrane lipids, including sphingolipids and phospholipids.	Arabidopsis 3-ketoacyl-coenzyme a synthase9 is involved in the synthesis of tetracosanoic acids as precursors of cuticular waxes, suberins, sphingolipids, and phospholipids.2013 · DOI: 10.1104/pp.112.210450
`At4g34510`	Active on saturated acyl-CoAs up to C22.	Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At1g19440`	3-ketoacyl-CoA synthase 4.	No verified direct reference in this release
`At4g34520`	Contributes to fatty acids elongation and stockage in developing seeds.	Engineering and mechanistic studies of the Arabidopsis FAE1 beta-ketoacyl-CoA synthase, FAE1 KCS.2002 · DOI: 10.1046/j.1432-1033.2002.03039.x Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162 Natural variation in seed very long chain fatty acid content is controlled by a new isoform of KCS18 in Arabidopsis thaliana.2012 · DOI: 10.1371/journal.pone.0049261 Directed tagging of the Arabidopsis FATTY ACID ELONGATION1 (FAE1) gene with the maize transposon activator.1995 · DOI: 10.1105/tpc.7.3.309 Very-long-chain fatty acid biosynthesis is controlled through the expression and specificity of the condensing enzyme.1997 · DOI: 10.1046/j.1365-313x.1997.12010121.x
`At2g15090`	3-ketoacyl-CoA synthase 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010923 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0160062 cutin-based cuticle development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0009922 fatty acid elongase activity Molecular Function

KEGG gene cross-reference

ath:AT1G19440

ath:AT2G16280

ath:AT4G34250

ath:AT4G34510

ath:AT4G34520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.381

Rank 1 · TkA03G555680 · TK1151

Nucleus0.272

Rank 2 · TkA03G555680 · TK1151

Mitochondrion0.220

Rank 3 · TkA03G555680 · TK1151

Endoplasmic reticulum0.107

Rank 4 · TkA03G555680 · TK1151

Cell membrane0.086

Rank 5 · TkA03G555680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08392FAE1_CUT1_RppA28-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G555680	`PF08392`	FAE1_CUT1_RppA	28	57	1.5e-09	38.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIX1`	Arabidopsis thaliana	sp\|Q9SIX1\|KCS9_ARATH 3-ketoacyl-CoA synthase 9	86.200%	Swiss-Prot	Low
`O65677`	Arabidopsis thaliana	sp\|O65677\|KCS17_ARATH 3-ketoacyl-CoA synthase 17	75.900%	Swiss-Prot	Low
`Q9LN49`	Arabidopsis thaliana	sp\|Q9LN49\|KCS4_ARATH 3-ketoacyl-CoA synthase 4	79.300%	Swiss-Prot	Low
`Q38860`	Arabidopsis thaliana	sp\|Q38860\|KCS18_ARATH 3-ketoacyl-CoA synthase 18	75.900%	Swiss-Prot	Low
`Q4V3C9`	Arabidopsis thaliana	sp\|Q4V3C9\|KCS8_ARATH 3-ketoacyl-CoA synthase 8	69.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card