TkA03G555140 | RubberDandelionOmics

Gene overview

TkA03G555140

Reference: TK1151 Chr: Chr03 Coordinates: 140557682-140559184 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · TkA03G555140|TK1151|cDNA

ATGAGTTACACACACGGGAATGAAGATAGGCTAAGCCATTTGCCTGAAGATGTTCTTTCACGTATACTCTCTTCAATCCCTACAAAATTGGCTGTGCGAACAAGCATCTTATCCAAAACATGGAGGTACAAATGGACGTTAGTCACAATCCTCGACTTTGACGACGATCACCCTATCGATGCTTTCCATTCCTTGTCAAATTTCGTAAACCGCGCTTTCAAACTCTGCCAAACATCCAAAATCAAGCGATTCCGTTTACG...

CDS

Download CDS FASTA

1311 bp · TkA03G555140|TK1151|CDS

ATGAGTTACACACACGGGAATGAAGATAGGCTAAGCCATTTGCCTGAAGATGTTCTTTCACGTATACTCTCTTCAATCCCTACAAAATTGGCTGTGCGAACAAGCATCTTATCCAAAACATGGAGGTACAAATGGACGTTAGTCACAATCCTCGACTTTGACGACGATCACCCTATCGATGCTTTCCATTCCTTGTCAAATTTCGTAAACCGCGCTTTCAAACTCTGCCAAACATCCAAAATCAAGCGATTCCGTTTACG...

Protein

Download Protein FASTA

436 aa · TkA03G555140|TK1151|PROTEIN

MSYTHGNEDRLSHLPEDVLSRILSSIPTKLAVRTSILSKTWRYKWTLVTILDFDDDHPIDAFHSLSNFVNRAFKLCQTSKIKRFRLRLAHYGLQTTYEAKSNISNWIKESVRLNVCEVDLYVTPFELPVTLFTCKTLTKLSLSGWGMEGYVGSNVSIILPLLKTLHITSPINLPGRVSVNSFRLIHSCPMLESLSLEIAMCNNQEDYNFNIPTLKRLKLKIVSVLSLNKVILILPNLESLSFAGLLRSLFVVKDLSSLVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G555140`
TK1151 ID	TkA03G555140
OH-1004 ID	LXL04_010956
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 96.330 / OH-1004 43.478 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G555140

Location Chr03:140557682-140559184 (-)

Description Similar to SUV3: DExH-box ATP-dependent RNA helicase DExH16, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56370`	FBD-associated F-box protein At5g56370.	No verified direct reference in this release
`At3g52670`	FBD-associated F-box protein At3g52670.	No verified direct reference in this release
`At5g22670`	Putative F-box/FBD/LRR-repeat protein At5g22670.	No verified direct reference in this release
`At3g59200`	F-box/LRR-repeat protein At3g59200.	No verified direct reference in this release
`At4g26340`	F-box/FBD/LRR-repeat protein At4g26340.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010956 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000965 mitochondrial RNA 3'-end processing Biological Process

GO:0009555 pollen development Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010929 positive regulation of auxin mediated signaling pathway Biological Process

GO:0016070 RNA metabolic process Biological Process

GO:0080038 positive regulation of cytokinin-activated signaling pathway Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

KEGG gene cross-reference

ath:AT4G14790

ath:AT5G39840

dosa:Os03g0746500

dosa:Os04g0459800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.820

Rank 1 · TkA03G555140 · TK1151

Cytoplasm0.274

Rank 2 · TkA03G555140 · TK1151

Cell membrane0.035

Rank 3 · TkA03G555140 · TK1151

Endoplasmic reticulum0.032

Rank 4 · TkA03G555140 · TK1151

Mitochondrion0.014

Rank 5 · TkA03G555140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box11-46 aa

PF12937F-box-like11-42 aa

PF24758LRR_At5g56370105-241 aa

PF00646F-box121-137 aa

PF24758LRR_At5g56370304-345 aa

PF03003Pox_G9-A16344-404 aa

PF08387FBD351-396 aa

PF24758LRR_At5g56370359-402 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G555140	`PF00646`	F-box	11	46	3.4e-06	27.5
TkA03G555140	`PF12937`	F-box-like	11	42	0.024	15.1
TkA03G555140	`PF24758`	LRR_At5g56370	105	241	1.1e-08	35.8
TkA03G555140	`PF00646`	F-box	121	137	3.4e-06	27.5
TkA03G555140	`PF24758`	LRR_At5g56370	304	345	1.1e-08	35.8
TkA03G555140	`PF03003`	Pox_G9-A16	344	404	0.054	14.0
TkA03G555140	`PF08387`	FBD	351	396	1.6e-11	44.6
TkA03G555140	`PF24758`	LRR_At5g56370	359	402	1.1e-08	35.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM94`	Arabidopsis thaliana	sp\|Q9FM94\|FBD21_ARATH FBD-associated F-box protein At5g56370	28.400%	Swiss-Prot	Low
`Q9LXJ7`	Arabidopsis thaliana	sp\|Q9LXJ7\|FBD11_ARATH FBD-associated F-box protein At3g52670	27.200%	Swiss-Prot	Low
`Q9FNJ4`	Arabidopsis thaliana	sp\|Q9FNJ4\|FDL32_ARATH Putative F-box/FBD/LRR-repeat protein At5g22670	28.100%	Swiss-Prot	Low
`Q9LX51`	Arabidopsis thaliana	sp\|Q9LX51\|FBL64_ARATH F-box/LRR-repeat protein At3g59200	25.800%	Swiss-Prot	Low
`Q8H1R7`	Arabidopsis thaliana	sp\|Q8H1R7\|FDL27_ARATH F-box/FBD/LRR-repeat protein At4g26340	27.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card