TkA03G552170 | RubberDandelionOmics

Gene overview

TkA03G552170

Reference: TK1151 Chr: Chr03 Coordinates: 139793928-139798052 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4057 bp · TkA03G552170|TK1151|cDNA

GCGCTCTACGCACCTTGCGTATCCAAGTCTCTCTCCTCTTTATCTCTGTTTCCCCATTAGTTAAAGCTACGTTGACTGTCATAATAACTACTCCTTCTTTGTCAAAAAGCTACAAATTTCAACCATTTCTGTCGCCGGGATCGTTTCTCAGACTCTGGCCGACGTTATCTCCGAGGATATATCCGACCTGGTGCTCGTCTTATATTTTATTGAATCTGTGCTGTCCAAGTGTTCATTTCCTAGTGCCTATTTTTGTCAAC...

CDS

Download CDS FASTA

3171 bp · TkA03G552170|TK1151|CDS

ATGAAGAGATTGAAATCGAGTGATGATCTTAACTCTTACGGAGGGGAAAAGGGCGTTTTTAAGGATTGGGGAAGAAAGGACGATGACTCAAGTCAACATCAGTCTTCATCACATAGAAGTTTCCATTACAAGTCCGAAAGTGGAAAAAGGGGTTTATCTTCTTCCTCATCTTCACGTTATGAAAGGGTAGATGATGATCGTAAGAATCCAAAGCTGGTACGAAAGAGGCCAGATTATGATGTCGATAGCTATGAAAGGAG...

Protein

Download Protein FASTA

1056 aa · TkA03G552170|TK1151|PROTEIN

MKRLKSSDDLNSYGGEKGVFKDWGRKDDDSSQHQSSSHRSFHYKSESGKRGLSSSSSSRYERVDDDRKNPKLVRKRPDYDVDSYERRKSYDRYRDSSERGILSSSPRGGYGGDRIHRSESFSGPRRDFPKGFRSERDRSRREGSVSSWRRFGGGKDVEEGTKSGSDSARGSKTVSEEVGNVRSPQNCRDAKSPPWSKDSGSEQSKSVEVKKSESLPEESGNNSEREEGELEPEPEPEPEPEPQSEPEHAPIVDNITEDPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G552170`
TK1151 ID	TkA03G552170
OH-1004 ID	LXL04_010849
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G552170

Location Chr03:139793928-139798052 (+)

Description Similar to OBE4: Protein OBERON 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63500`	Probable transcription factor that functions redundantly with OBE3 in specification of the hypophysis and establishment of the embryonic root.	OBE3 and WUS Interaction in Shoot Meristem Stem Cell Regulation.2016 · DOI: 10.1371/journal.pone.0155657
`At1g14740`	Probable transcription factor that functions redundantly with OBE4 in specification of the hypophysis and establishment of the embryonic root.	OBE3 and WUS Interaction in Shoot Meristem Stem Cell Regulation.2016 · DOI: 10.1371/journal.pone.0155657

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0239200`	Probable transcription factor that functions as a regulator of metal transporter genes responsible for essential metals delivery to shoots and normal plant growth.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010849 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001708 cell fate specification Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0010071 root meristem specification Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0046740 transport of virus in host, cell to cell Biological Process

GO:0080022 primary root development Biological Process

GO:0090421 embryonic meristem initiation Biological Process

GO:0098659 inorganic cation import across plasma membrane Biological Process

KEGG gene cross-reference

ath:AT1G14740

ath:AT3G63500

ath:AT5G48160

dosa:Os03g0239200

osa:4332199

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.975

Rank 1 · TkA03G552170 · TK1151

Cytoplasm0.079

Rank 2 · TkA03G552170 · TK1151

Cell membrane0.028

Rank 3 · TkA03G552170 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA03G552170 · TK1151

Plastid0.010

Rank 5 · TkA03G552170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07227PHD_Oberon740-867 aa

PF16312Oberon_cc946-1044 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G552170	`PF07227`	PHD_Oberon	740	867	3.6e-37	127.9
TkA03G552170	`PF16312`	Oberon_cc	946	1044	1.2e-38	132.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TI3`	Arabidopsis thaliana	sp\|Q84TI3\|OBE4_ARATH Protein OBERON 4	41.600%	Swiss-Prot	Medium
`Q94B71`	Arabidopsis thaliana	sp\|Q94B71\|OBE3_ARATH Protein OBERON 3	36.500%	Swiss-Prot	Medium
`Q10PC5`	Oryza sativa subsp. japonica	sp\|Q10PC5\|TTA1_ORYSJ Protein TITANIA	40.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card