TkA03G550860 | RubberDandelionOmics

Gene overview

TkA03G550860

Reference: TK1151 Chr: Chr03 Coordinates: 139427983-139428462 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA03G550860|TK1151|cDNA

ATGCATCTTCCACGTATCCCCAACCGACGGCCCACGTGTAACCCATTTCCTTTCGAAATAACCTCGACCACATCGAACCCTCTCCTACGTACCCCCTTCTATTCCACTCATCTCCCACTGCTGTCCAAAACACTAATAATGGGTACCACCACCACCCGCACCGCCACCAGAAAGTATCTGGTTCGTCTTCCTCAGCACCGTGGCGAAAACCCGCCGCCGCCGCAGCAACAGGTGCCGAAAGGGTGTTTGGCGGTGAAAGT...

CDS

Download CDS FASTA

480 bp · TkA03G550860|TK1151|CDS

ATGCATCTTCCACGTATCCCCAACCGACGGCCCACGTGTAACCCATTTCCTTTCGAAATAACCTCGACCACATCGAACCCTCTCCTACGTACCCCCTTCTATTCCACTCATCTCCCACTGCTGTCCAAAACACTAATAATGGGTACCACCACCACCCGCACCGCCACCAGAAAGTATCTGGTTCGTCTTCCTCAGCACCGTGGCGAAAACCCGCCGCCGCCGCAGCAACAGGTGCCGAAAGGGTGTTTGGCGGTGAAAGT...

Protein

Download Protein FASTA

159 aa · TkA03G550860|TK1151|PROTEIN

MHLPRIPNRRPTCNPFPFEITSTTSNPLLRTPFYSTHLPLLSKTLIMGTTTTRTATRKYLVRLPQHRGENPPPPQQQVPKGCLAVKVGEAGGEQLRFVVPVIYFNHPLFMQLLKVAEEEYGFEQKGTITIPCNVHHFRTIINRIIHHQNSAGCFRVLIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G550860`
TK1151 ID	TkA03G550860
OH-1004 ID	LXL04_010828
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.100
Protein coverage (%)	TK1151 71.069 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G550860

Location Chr03:139427983-139428462 (+)

Description Similar to SAUR32: Auxin-responsive protein SAUR32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46690`	May play a role in the apical hook development (Ref.7).	No verified direct reference in this release
`At2g45210`	Acts a positive regulator of leaf senescence and may mediate auxin-induced leaf senescence.	SAUR36, a small auxin up RNA gene, is involved in the promotion of leaf senescence in Arabidopsis.2013 · DOI: 10.1104/pp.112.212787 Auxin and gibberellin responsive Arabidopsis SMALL AUXIN UP RNA36 regulates hypocotyl elongation in the light.2013 · DOI: 10.1007/s00299-013-1406-5
`At3g12830`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion.	No verified direct reference in this release
`At2g18010`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion (By similarity).	FRUITFULL controls SAUR10 expression and regulates Arabidopsis growth and architecture.2017 · DOI: 10.1093/jxb/erx184 Divergent regulation of Arabidopsis SAUR genes: a focus on the SAUR10-clade.2017 · DOI: 10.1186/s12870-017-1210-4

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010828 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009266 response to temperature stimulus Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0060918 auxin transport Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:1900140 regulation of seedling development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G16510

ath:AT2G45210

ath:AT2G46690

ath:AT3G03820

ath:AT4G38850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.504

Rank 1 · TkA03G550860 · TK1151

Nucleus0.403

Rank 2 · TkA03G550860 · TK1151

Cell membrane0.149

Rank 3 · TkA03G550860 · TK1151

Endoplasmic reticulum0.099

Rank 4 · TkA03G550860 · TK1151

Mitochondrion0.050

Rank 5 · TkA03G550860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519Auxin_inducible69-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G550860	`PF02519`	Auxin_inducible	69	144	4.2e-21	75.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUZ3`	Arabidopsis thaliana	sp\|Q9ZUZ3\|SAU32_ARATH Auxin-responsive protein SAUR32	61.200%	Swiss-Prot	Low
`O22150`	Arabidopsis thaliana	sp\|O22150\|SAU36_ARATH Auxin-responsive protein SAUR36	49.300%	Swiss-Prot	Low
`Q9LTV3`	Arabidopsis thaliana	sp\|Q9LTV3\|SAU72_ARATH Auxin-responsive protein SAUR72	44.800%	Swiss-Prot	Low
`Q9SL45`	Arabidopsis thaliana	sp\|Q9SL45\|SAU10_ARATH Protein SMALL AUXIN UP-REGULATED RNA 10	41.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card