TkA03G550840 | RubberDandelionOmics

Gene overview

TkA03G550840

Reference: TK1151 Chr: Chr03 Coordinates: 139425171-139425791 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

576 bp · TkA03G550840|TK1151|cDNA

ATGTCTTTGCTTTTCAAATTGGATTCAATTCGTGGTGTTGATAATGGCGTTAGGCTTTTGAGGAAAGCGGTTACCAGTAAGGCCATCGCGTTGCAGGAGAAGGTGGACACAATTGCCCAGGCTGAATCGGATCAGCGCACCCTAGAGGTGACGGAAACCTCCGGCGACACTGGTAATCTGCAATCCGTAGAGGATGGTGCCGATGACGATGTCGTAAACGAGATGGTTGAGAATTGCAATCTCGTTAACGCAGCAGAGAC...

CDS

Download CDS FASTA

576 bp · TkA03G550840|TK1151|CDS

ATGTCTTTGCTTTTCAAATTGGATTCAATTCGTGGTGTTGATAATGGCGTTAGGCTTTTGAGGAAAGCGGTTACCAGTAAGGCCATCGCGTTGCAGGAGAAGGTGGACACAATTGCCCAGGCTGAATCGGATCAGCGCACCCTAGAGGTGACGGAAACCTCCGGCGACACTGGTAATCTGCAATCCGTAGAGGATGGTGCCGATGACGATGTCGTAAACGAGATGGTTGAGAATTGCAATCTCGTTAACGCAGCAGAGAC...

Protein

Download Protein FASTA

191 aa · TkA03G550840|TK1151|PROTEIN

MSLLFKLDSIRGVDNGVRLLRKAVTSKAIALQEKVDTIAQAESDQRTLEVTETSGDTGNLQSVEDGADDDVVNEMVENCNLVNAAETCDVEEDIKTSPTADLTEIGEDDHTSIAKDNDTNDDKGNRELLEKLSVDNEKMIKVMMQISERNEMQTRMINSLSRRVEQLEKAFMTEKQRKKKKTRRDKDNYCI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G550840`
TK1151 ID	TkA03G550840
OH-1004 ID	LXL04_010827
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.700
Protein coverage (%)	TK1151 100.000 / OH-1004 64.174 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G550840`
Location	Chr03:139425171-139425791 (-)
Description	Similar to BAG5: BAG family molecular chaperone regulator 5, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010827` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0006914 autophagy Biological Process GO:0009408 response to heat Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0012502 induction of programmed cell death Biological Process GO:0034605 cellular response to heat Biological Process GO:0034620 cellular response to unfolded protein Biological Process GO:0050832 defense response to fungus Biological Process GO:0070417 cellular response to cold Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference	ath:AT1G12060 ath:AT2G46240 ath:AT5G62390 dosa:Os02g0719700 osa:4330543 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.664

Rank 1 · TkA03G550840 · TK1151

Cytoplasm0.280

Rank 2 · TkA03G550840 · TK1151

Cell membrane0.069

Rank 3 · TkA03G550840 · TK1151

Mitochondrion0.051

Rank 4 · TkA03G550840 · TK1151

Golgi apparatus0.038

Rank 5 · TkA03G550840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02179BAG1-37 aa

PF26891Phage_N4_Gp122-41 aa

PF02179BAG67-79 aa

PF05283MGC-2471-112 aa

PF22790YkoP128-179 aa

PF27452KefB_C136-183 aa

PF26891Phage_N4_Gp1137-189 aa

PF02179BAG157-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G550840	`PF02179`	BAG	1	37	0.00011	23.3
TkA03G550840	`PF26891`	Phage_N4_Gp1	22	41	0.038	15.0
TkA03G550840	`PF02179`	BAG	67	79	0.00011	23.3
TkA03G550840	`PF05283`	MGC-24	71	112	0.11	13.6
TkA03G550840	`PF22790`	YkoP	128	179	0.073	13.0
TkA03G550840	`PF27452`	KefB_C	136	183	0.051	14.5
TkA03G550840	`PF26891`	Phage_N4_Gp1	137	189	0.038	15.0
TkA03G550840	`PF02179`	BAG	157	180	0.00011	23.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card