TkA03G545690 | RubberDandelionOmics

Gene overview

TkA03G545690

Reference: TK1151 Chr: Chr03 Coordinates: 137671991-137674489 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1491 bp · TkA03G545690|TK1151|cDNA

ATGGTATTCTCGAGTAAAAACCAAGTACGTTTGTCAAAGATTGCGACAAGTGATCAACATGGTGAGAATTCACCGTATTTTGATGGATGGAAAGCTTATGATCAAGATCCATTTCATCATACCGAAAACCCAAATGGTGTCATACAAATGGGATTAGCAGAAAACCAGCTTTCTCCTGATTTAATTCAGAAATGGATTTTAAAGAACCCGAAAGCATCAATCTGTACCAATGATGGAGCTGACAATTTTAAAGATATTGC...

CDS

Download CDS FASTA

1491 bp · TkA03G545690|TK1151|CDS

ATGGTATTCTCGAGTAAAAACCAAGTACGTTTGTCAAAGATTGCGACAAGTGATCAACATGGTGAGAATTCACCGTATTTTGATGGATGGAAAGCTTATGATCAAGATCCATTTCATCATACCGAAAACCCAAATGGTGTCATACAAATGGGATTAGCAGAAAACCAGCTTTCTCCTGATTTAATTCAGAAATGGATTTTAAAGAACCCGAAAGCATCAATCTGTACCAATGATGGAGCTGACAATTTTAAAGATATTGC...

Protein

Download Protein FASTA

496 aa · TkA03G545690|TK1151|PROTEIN

MVFSSKNQVRLSKIATSDQHGENSPYFDGWKAYDQDPFHHTENPNGVIQMGLAENQLSPDLIQKWILKNPKASICTNDGADNFKDIANFQDYHGLYEFRKAIADFMGKVRGNRVEFDPDRIVMGGGATGASESLMFCLADPGDGFLVPTPYYPAFDRDLKWRTGAQLIPIICKSSNDFKITKEALESAYENAIKSNIKVKGLIIANPSNPLGTTMDKETLKTLLKFINEKSIHLVCDEIYAATVFNTPDFISISEVLQEM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G545690`
TK1151 ID	TkA03G545690
OH-1004 ID	LXL04_026406
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	66.500
Protein coverage (%)	TK1151 97.581 / OH-1004 97.320 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G545690`
Location	Chr03:137671991-137674489 (+)
Description	Similar to ACS1: 1-aminocyclopropane-1-carboxylate synthase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026406` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006520 amino acid metabolic process Biological Process GO:0006952 defense response Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009414 response to water deprivation Biological Process GO:0009611 response to wounding Biological Process GO:0009612 response to mechanical stimulus Biological Process GO:0009693 ethylene biosynthetic process Biological Process GO:0009723 response to ethylene Biological Process GO:0009733 response to auxin Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009835 fruit ripening Biological Process GO:0010087 phloem or xylem histogenesis Biological Process
KEGG gene cross-reference	ath:AT4G11280 gmx:547976 nta:107831434 sly:606304 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · TkA03G545690 · TK1151

Nucleus0.230

Rank 2 · TkA03G545690 · TK1151

Plastid0.145

Rank 3 · TkA03G545690 · TK1151

Peroxisome0.090

Rank 4 · TkA03G545690 · TK1151

Mitochondrion0.077

Rank 5 · TkA03G545690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155Aminotran_1_248-433 aa

PF08986DUF1889206-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G545690	`PF00155`	Aminotran_1_2	48	433	7.2e-106	355.1
TkA03G545690	`PF08986`	DUF1889	206	242	0.29	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card