TkA03G545170 | RubberDandelionOmics

Gene overview

TkA03G545170

Reference: TK1151 Chr: Chr03 Coordinates: 137515386-137516141 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

671 bp · TkA03G545170|TK1151|cDNA

GAAAGTCGCTGGTATGCAATAAATGAGAAGGGGCATATATGGTATGTCCAGCTGGATATTTACGTCAGCGTTTACCCACGCGCACGTTAGTACCACCCACCATCACATAAAAATCAAAGTCTTCGAACTAGTCTAACGTAACCACACCTCCCCGCCATATATCTCGTTCTCTTTCTTTGTCGCCATGTACGGTGGCCGGAAAGATAGCTCCGGCACGCGTACACCTGAACGTGTTACTTATCCTCCTAATTCCCCGTCCC...

CDS

Download CDS FASTA

357 bp · TkA03G545170|TK1151|CDS

ATGTACGGTGGCCGGAAAGATAGCTCCGGCACGCGTACACCTGAACGTGTTACTTATCCTCCTAATTCCCCGTCCCCAAGCTCCTATTCTACCAGTTCATCCAGGTCCTCAGCGAGCGACCGAGTTAAATCTGCCGCTAGATCCGTCGCCGGAGTTTTCGTAGCTTGTTTTACACCACCGGAGGAGGAGACGCAGCATAGCTCCTCGGGTTTGGAGGTTCTGATGCGTTCAGCTCAACATCAGGTAAATCATTTTGAGCA...

Protein

Download Protein FASTA

118 aa · TkA03G545170|TK1151|PROTEIN

MYGGRKDSSGTRTPERVTYPPNSPSPSSYSTSSSRSSASDRVKSAARSVAGVFVACFTPPEEETQHSSSGLEVLMRSAQHQVNHFEHRMTRSDEVMLRLLVLPVNKAVRRDFVIHYST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G545170`
TK1151 ID	TkA03G545170
OH-1004 ID	LXL04_010724
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 59.322 / OH-1004 15.873 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G545170`
Location	Chr03:137515386-137516141 (+)
Description	Similar to CRCK2: Calmodulin-binding receptor-like cytoplasmic kinase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010724` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009409 response to cold Biological Process GO:0009555 pollen development Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0080092 regulation of pollen tube growth Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0016324 apical plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT2G11520 ath:AT2G21480 ath:AT4G00330 ath:AT4G39110 ath:AT5G58940 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.365

Rank 1 · TkA03G545170 · TK1151

Nucleus0.311

Rank 2 · TkA03G545170 · TK1151

Mitochondrion0.239

Rank 3 · TkA03G545170 · TK1151

Cell membrane0.152

Rank 4 · TkA03G545170 · TK1151

Endoplasmic reticulum0.139

Rank 5 · TkA03G545170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17067RPS317-24 aa

PF17461DUF542317-84 aa

PF17067RPS3138-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G545170	`PF17067`	RPS31	7	24	2.2	9.2
TkA03G545170	`PF17461`	DUF5423	17	84	0.44	10.1
TkA03G545170	`PF17067`	RPS31	38	72	2.2	9.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card