Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1710 bp · TkA03G544460|TK1151|cDNA
GTTACTAGTTTATAGTGTTTTTATTACTTCATATTTATAACAAAAAATAATATTAAATATTTGGAAAAACCTCATTCACATAACTGTTTCCAACAACCATCCACTCTCTCTCCCTCACTACAAACCTCTGCACTCTTCACTTCACTGAAGCTCCCAAACAATGTCCCCTCTCTCCCCTTCCCCTCAAACCCCAACTGTAAATCCCCTCCATGGCCGCACTAAAATCTTCCTTTCGTATCACACCATCATCATCTTCACAG...
1239 bp · TkA03G544460|TK1151|CDS
ATGGCCGCACTAAAATCTTCCTTTCGTATCACACCATCATCATCTTCACAGTTCCCTCCCTGGACACCCTACAAACTCCCATCAAAACCCTCCAAAATCCTCTGTTCTCGAAACCCTAATCCACCATCTCCTCCAACCCCCATAAACCTAATCTCAATTCTTCGAGTAATTCCCGATTGGGCCGATGCAATACAGGAGAGTCGTTTGAAACAGAAGAGGCCACTTTACAAATACGAAGATTGGGTTGAGCACAGAAGCTC...
Protein
Download Protein FASTA412 aa · TkA03G544460|TK1151|PROTEIN
MAALKSSFRITPSSSSQFPPWTPYKLPSKPSKILCSRNPNPPSPPTPINLISILRVIPDWADAIQESRLKQKRPLYKYEDWVEHRSSLRHLRHLLSSLSSRVILSLVPPVLAFTAVAVLVASYNTAVFWDLLPEFFPTLRASSLPYQLTAPALALLLVFRTEASYSRFEEGRKAWTKVISGTNDFARQVIVSVETESVLKTAILQYILAFPVALKCHMIHGSDIGEDLKNLLEDDDLELVLSSTHRPRCIIQLISQCLQL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G544460 |
|---|---|
| TK1151 ID | TkA03G544460 |
| OH-1004 ID | LXL04_010702 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G544460 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:137302356-137304301 (+) | |||||||||
| Description | Similar to At3g61320: UPF0187 protein At3g61320, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006811 monoatomic ion transport Biological Process GO:0010027 thylakoid membrane organization Biological Process GO:0019684 photosynthesis, light reaction Biological Process GO:0042548 regulation of photosynthesis, light reaction Biological Process GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009533 chloroplast stromal thylakoid Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0034707 chloride channel complex Cellular Component GO:0042651 thylakoid membrane Cellular Component GO:0005247 voltage-gated chloride channel activity Molecular Function | |||||||||
| KEGG gene cross-reference | ana:alr2987 ath:AT2G45870 ath:AT3G61320 rso:RSc3414 syn:sll1024 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF22119GST_C_854-156 aaPF25539Bestrophin_281-367 aaPF30996FunZ_C153-181 aaPF08766DEK_C223-238 aaPF30996FunZ_C242-262 aaPF08766DEK_C370-391 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G544460 | PF22119 | GST_C_8 | 54 | 156 | 0.03 | 15.4 |
| TkA03G544460 | PF25539 | Bestrophin_2 | 81 | 367 | 4.3e-86 | 289.7 |
| TkA03G544460 | PF30996 | FunZ_C | 153 | 181 | 0.027 | 15.1 |
| TkA03G544460 | PF08766 | DEK_C | 223 | 238 | 3.7 | 8.3 |
| TkA03G544460 | PF30996 | FunZ_C | 242 | 262 | 0.027 | 15.1 |
| TkA03G544460 | PF08766 | DEK_C | 370 | 391 | 3.7 | 8.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.