Gene Card
Gene overview
cDNA / CDS / Protein Sequences
710 bp · TkA03G539030|TK1151|cDNA
ATGTGTGATGATAGATTTAGAATTAGCGACATTTTTCCAAATTCCCAATTTACCCCTCGTTCATACACACAAAGAAATAACCATGGCCCATGTGCCCTATATATATATCGTTACCTCATTTTCTCGAATATATCCAAATCTTTCACTCGCTTCTCACACACGTACCGGAAGTAAGAGGCGAAAAGAATATGTGTCTTGGCACCTCCAAAGAAAACTTATATCATCGCTCATATCTCACAACTCACCAAGAACAACACAAG...
441 bp · TkA03G539030|TK1151|CDS
ATGTGCCCTATATATATATCGTTACCTCATTTTCTCGAATATATCCAAATCTTTCACTCGCTTCTCACACACGTACCGGAAGTAAGAGGCGAAAAGAATATGTGTCTTGGCACCTCCAAAGAAAACTTATATCATCGCTCATATCTCACAACTCACCAAGAACAACACAAGAGATCATCAATCTTTCACTTCCATCATCTACAAAGAAAAAGAGTTATGAGTATGAAAAATTCAAGAAACCAAACAAGGGTCATGTTTGT...
Protein
Download Protein FASTA146 aa · TkA03G539030|TK1151|PROTEIN
MCPIYISLPHFLEYIQIFHSLLTHVPEVRGEKNMCLGTSKENLYHRSYLTTHQEQHKRSSIFHFHHLQRKRVMSMKNSRNQTRVMFVTLKRKMAMKNLKLYMQNQCIIEENQKLRRKALLLHQENQVLFYQLQNVKINKHNTDVIV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G539030 |
|---|---|
| TK1151 ID | TkA03G539030 |
| OH-1004 ID | LXL04_014816 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 47.200 |
| Protein coverage (%) | TK1151 36.301 / OH-1004 26.768Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G539030 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:135743590-135744645 (-) | |||||||||
| Description | Similar to ZPR3: Protein LITTLE ZIPPER 3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0009943 adaxial/abaxial axis specification Biological Process GO:0010073 meristem maintenance Biological Process GO:0010075 regulation of meristem growth Biological Process GO:0010305 leaf vascular tissue pattern formation Biological Process GO:0010358 leaf shaping Biological Process GO:0005634 nucleus Cellular Component GO:0140297 DNA-binding transcription factor binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G52770 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24715YxiF16-69 aaPF30007BAG2_N27-41 aaPF28489TUSC143-73 aaPF24715YxiF61-136 aaPF30007BAG2_N69-99 aaPF30681ZPR88-134 aaPF28489TUSC1102-132 aaPF30007BAG2_N112-140 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G539030 | PF24715 | YxiF | 16 | 69 | 0.45 | 11.3 |
| TkA03G539030 | PF30007 | BAG2_N | 27 | 41 | 0.31 | 12.0 |
| TkA03G539030 | PF28489 | TUSC1 | 43 | 73 | 1.6 | 9.3 |
| TkA03G539030 | PF24715 | YxiF | 61 | 136 | 0.45 | 11.3 |
| TkA03G539030 | PF30007 | BAG2_N | 69 | 99 | 0.31 | 12.0 |
| TkA03G539030 | PF30681 | ZPR | 88 | 134 | 2.3e-17 | 63.8 |
| TkA03G539030 | PF28489 | TUSC1 | 102 | 132 | 1.6 | 9.3 |
| TkA03G539030 | PF30007 | BAG2_N | 112 | 140 | 0.31 | 12.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.