TkA03G518600 | RubberDandelionOmics

Gene overview

TkA03G518600

Reference: TK1151 Chr: Chr03 Coordinates: 130133383-130133822 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkA03G518600|TK1151|cDNA

CTCTGTTTTATACTCCCCATATCCAACCACACCTTTCAATTTTTTCTGCCACCCTACGGAGAAACCTTTTTTAATCAACCCACCGACCGTTGCTCCAATGGCCGATTGTTCATCGATTTCGTCGCTGAAAGCCTTCGTCTGCCATTTGCACCACCGTATGTGGGCAGCAACGCCATGGAGTTGAGCGAAGGAGTGAATTACGCGGTGGCAGGTGCTACGACGTTGGATCCGTGGTTTCTTGAATCGAGAGGGTTTTATAA...

CDS

Download CDS FASTA

348 bp · TkA03G518600|TK1151|CDS

CTCTGTTTTATACTCCCCATATCCAACCACACCTTTCAATTTTTTCTGCCACCCTACGGAGAAACCTTTTTTAATCAACCCACCGACCGTTGCTCCAATGGCCGATTGTTCATCGATTTCGTCGCTGAAAGCCTTCGTCTGCCATTTGCACCACCGTATGTGGGCAGCAACGCCATGGAGTTGAGCGAAGGAGTGAATTACGCGGTGGCAGGTGCTACGACGTTGGATCCGTGGTTTCTTGAATCGAGAGGGTTTTATAA...

Protein

Download Protein FASTA

115 aa · TkA03G518600|TK1151|PROTEIN

LCFILPISNHTFQFFLPPYGETFFNQPTDRCSNGRLFIDFVAESLRLPFAPPYVGSNAMELSEGVNYAVAGATTLDPWFLESRGFYNKLTNASLGVQMRWFKESLASLYETAQST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G518600`
TK1151 ID	TkA03G518600
OH-1004 ID	LXL04_010977
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.900
Protein coverage (%)	TK1151 91.304 / OH-1004 9.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G518600

Location Chr03:130133383-130133822 (+)

Description Similar to EMB2279: Pentatricopeptide repeat-containing protein At1g30610, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28590`	GDSL esterase/lipase At1g28590.	No verified direct reference in this release
`At5g45910`	GDSL esterase/lipase At5g45910.	No verified direct reference in this release
`At3g48460`	GDSL esterase/lipase At3g48460.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010977 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005976 polysaccharide metabolic process Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010239 chloroplast mRNA processing Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0042793 plastid transcription Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G28570

ath:AT1G28580

ath:AT1G28590

ath:AT1G30610

ath:AT5G67570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.339

Rank 1 · TkA03G518600 · TK1151

Nucleus0.294

Rank 2 · TkA03G518600 · TK1151

Extracellular0.129

Rank 3 · TkA03G518600 · TK1151

Plastid0.123

Rank 4 · TkA03G518600 · TK1151

Mitochondrion0.094

Rank 5 · TkA03G518600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL21-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G518600	`PF00657`	Lipase_GDSL	21	90	9.7e-05	23.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXT9`	Arabidopsis thaliana	sp\|Q8RXT9\|GDL8_ARATH GDSL esterase/lipase At1g28590	57.600%	Swiss-Prot	High
`Q9FJ45`	Arabidopsis thaliana	sp\|Q9FJ45\|GDL83_ARATH GDSL esterase/lipase At5g45910	47.500%	Swiss-Prot	Medium
`Q9STM6`	Arabidopsis thaliana	sp\|Q9STM6\|GDL57_ARATH GDSL esterase/lipase At3g48460	41.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card