TkA03G480830 | RubberDandelionOmics

Gene overview

TkA03G480830

Reference: TK1151 Chr: Chr03 Coordinates: 120258436-120260980 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2331 bp · TkA03G480830|TK1151|cDNA

ATGTGTACGGTCATAAACTCACCAGGAGGGCGACCTAAATTCTGGATACCAATAGTGGGAACACATGTTGAGATAGATAAAGAGCGTATTTTTGATACACTACAAGAAGGTCTTAATGCATACTATATATATGCAAAACATGCCGGATTCGACACAAGACTTGGTTCGGAAAAAACAAAGAACGACATTCTACAATATAAATACGTTTTTTGTAATCGAGCCGGAGAAGCTAAAAAGTACAATGTAGACACGTCCAATGG...

CDS

Download CDS FASTA

2331 bp · TkA03G480830|TK1151|CDS

ATGTGTACGGTCATAAACTCACCAGGAGGGCGACCTAAATTCTGGATACCAATAGTGGGAACACATGTTGAGATAGATAAAGAGCGTATTTTTGATACACTACAAGAAGGTCTTAATGCATACTATATATATGCAAAACATGCCGGATTCGACACAAGACTTGGTTCGGAAAAAACAAAGAACGACATTCTACAATATAAATACGTTTTTTGTAATCGAGCCGGAGAAGCTAAAAAGTACAATGTAGACACGTCCAATGG...

Protein

Download Protein FASTA

776 aa · TkA03G480830|TK1151|PROTEIN

MCTVINSPGGRPKFWIPIVGTHVEIDKERIFDTLQEGLNAYYIYAKHAGFDTRLGSEKTKNDILQYKYVFCNRAGEAKKYNVDTSNGEKGKQKRKKASHMSKCPARICFKVLEDGSFRYCVNKLEEMHNHELYTNTTVHMAKHKRKLDFFDMTLINQLSQKNIGASKAHHMIGGIKGDNQGPKCSDYKIFSRDLNRYIEDTDANILVELMNLRKENVRDFSFVHLLEDSELRAVFWADNVAKRNYKEFSDIVSFDATYHT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G480830`
TK1151 ID	TkA03G480830
OH-1004 ID	LXL04_022310
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.200
Protein coverage (%)	TK1151 100.000 / OH-1004 94.810 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G480830

Location Chr03:120258436-120260980 (-)

Description Similar to FAR1: Protein FAR-RED IMPAIRED RESPONSE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27110`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At3g06250`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At5g18960`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022310 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010018 far-red light signaling pathway Biological Process

GO:0010218 response to far red light Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G52520

ath:AT1G76320

ath:AT3G22170

ath:AT4G15090

ath:AT4G38180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.931

Rank 1 · TkA03G480830 · TK1151

Cytoplasm0.136

Rank 2 · TkA03G480830 · TK1151

Mitochondrion0.023

Rank 3 · TkA03G480830 · TK1151

Cell membrane0.016

Rank 4 · TkA03G480830 · TK1151

Extracellular0.009

Rank 5 · TkA03G480830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03101FAR141-133 aa

PF21056ZSWIM1-3_RNaseH-like221-306 aa

PF10551MULE252-343 aa

PF04434SWIM557-586 aa

PF03101FAR1721-756 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G480830	`PF03101`	FAR1	41	133	7.5e-08	33.7
TkA03G480830	`PF21056`	ZSWIM1-3_RNaseH-like	221	306	7.4e-06	26.6
TkA03G480830	`PF10551`	MULE	252	343	2.9e-23	82.8
TkA03G480830	`PF04434`	SWIM	557	586	0.00033	20.8
TkA03G480830	`PF03101`	FAR1	721	756	7.5e-08	33.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVC9`	Arabidopsis thaliana	sp\|Q9ZVC9\|FRS3_ARATH Protein FAR1-RELATED SEQUENCE 3	24.300%	Swiss-Prot	Low
`Q9M8J3`	Arabidopsis thaliana	sp\|Q9M8J3\|FRS7_ARATH Protein FAR1-RELATED SEQUENCE 7	24.800%	Swiss-Prot	Low
`Q3E7I5`	Arabidopsis thaliana	sp\|Q3E7I5\|FRS12_ARATH Protein FAR1-RELATED SEQUENCE 12	25.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card