TkA03G469420 | RubberDandelionOmics

Gene overview

TkA03G469420

Reference: TK1151 Chr: Chr03 Coordinates: 117304666-117307749 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1844 bp · TkA03G469420|TK1151|cDNA

CTTGTATCCAATAAAAAACAAAAAATCTTCAGGTCCCAATTTTGACAAGCAATCACGGTCTTCCCGGAATTGCAATCTGTCTCTCAAAATCCTCCGTATCCCCGCCCAATTTACGAACCTCCACTGCAAATCCAACCAATTGACCAGGGTTTTGGGGTCAAGCTTTCGATTTCGAGGGAAAAGAATCATCATAATCGCTTAATCAACCTTGTACATCTTCAAGAGTCGTCTGCTAGTTCATTGAAGCAAACCCTTGTTTT...

CDS

Download CDS FASTA

1476 bp · TkA03G469420|TK1151|CDS

ATGAACAAGTTGGGAGGAGGAGACTTTGCTAATCTGGTCGTAGCTCTCAAGTTTTCTCCACCTCCATGGCCAACCGTAATTGCTGGTGTCTTTGTTTTCATCAGTCTAACCCTTTCAATTTACTTGCTGTTCGAACACCTCTCTGCTTACAAGAATCCCGAGGAACAGAAGTTTTTGTTTGGCATTATACTCATGGCGCCTTGTTATGCAGTTGAATCATTTATATCTCTGTTGAATCCATCAATTAGTGTTGATATCGA...

Protein

Download Protein FASTA

491 aa · TkA03G469420|TK1151|PROTEIN

MNKLGGGDFANLVVALKFSPPPWPTVIAGVFVFISLTLSIYLLFEHLSAYKNPEEQKFLFGIILMAPCYAVESFISLLNPSISVDIEILRDCYEAFAMYCFGRYLVACLGGEDRTIEFLEREGRAGSKTPLLEPSSDHGTFKHVFPMNLFLKPWRLGQRVYLIIKIGIVQYMIIKAFTAVLAVILEAFDVYCEGEFKWSCGYPYMAVILNFSQSWALYCLVMFYEITADELSHIHPLAKFLTFKSIVFLTWWQGVAIALL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G469420`
TK1151 ID	TkA03G469420
OH-1004 ID	LXL04_009760
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.185 / OH-1004 89.687 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G469420

Location Chr03:117304666-117307749 (+)

Description Similar to LAZ1: Protein LAZ1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38360`	Required for programmed cell death (PCD) associated with hypersensitive response (HR).	Lazarus1, a DUF300 protein, contributes to programmed cell death associated with Arabidopsis acd11 and the hypersensitive response.2010 · DOI: 10.1371/journal.pone.0012586
`At1g77220`	Protein LAZ1 homolog 1.	No verified direct reference in this release
`At1g23070`	Protein LAZ1 homolog 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009760 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007033 vacuole organization Biological Process

GO:0012501 programmed cell death Biological Process

GO:0098876 vesicle-mediated transport to the plasma membrane Biological Process

GO:1900458 negative regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G23070

ath:AT1G77220

ath:AT4G38360

bta:504966

hsa:55751

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.358

Rank 1 · TkA03G469420 · TK1151

Lysosome / Vacuole0.306

Rank 2 · TkA03G469420 · TK1151

Cytoplasm0.173

Rank 3 · TkA03G469420 · TK1151

Endoplasmic reticulum0.162

Rank 4 · TkA03G469420 · TK1151

Golgi apparatus0.139

Rank 5 · TkA03G469420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03619Solute_trans_a25-305 aa

PF00305Lipoxygenase228-241 aa

PF00305Lipoxygenase386-418 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G469420	`PF03619`	Solute_trans_a	25	305	1.2e-92	310.8
TkA03G469420	`PF00305`	Lipoxygenase	228	241	0.21	10.7
TkA03G469420	`PF00305`	Lipoxygenase	386	418	0.21	10.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JTN2`	Arabidopsis thaliana	sp\|F4JTN2\|LAZ1_ARATH Protein LAZ1	70.600%	Swiss-Prot	High
`Q94CA0`	Arabidopsis thaliana	sp\|Q94CA0\|LAZH1_ARATH Protein LAZ1 homolog 1	56.500%	Swiss-Prot	High
`Q5BPZ5`	Arabidopsis thaliana	sp\|Q5BPZ5\|LAZH2_ARATH Protein LAZ1 homolog 2	44.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card