TkA03G463490 | RubberDandelionOmics

Gene overview

TkA03G463490

Reference: TK1151 Chr: Chr03 Coordinates: 115688968-115691758 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1671 bp · TkA03G463490|TK1151|cDNA

TTGTGATACAGCATACCATGCATTTTAGTCTAAATAATTTGACCCTACAAGACTTTTCTTTCTCCTTCCTAACGCGATCATTTTGTTTTAAATTGAGTGTTCGCATCATCGACCATTGTAGATGAGATTTTTGAGATGTAAGGAAGGAGAGATTGTTTTAGAGAAAAGGATTCATATAATAAACAATGGAGATGATATCGTATGCAAGACCGTGCCAGAGTACTATTTCACACCTCCAGAATCTGAGCAACCTGACCGGA...

CDS

Download CDS FASTA

1473 bp · TkA03G463490|TK1151|CDS

ATGAGATTTTTGAGATGTAAGGAAGGAGAGATTGTTTTAGAGAAAAGGATTCATATAATAAACAATGGAGATGATATCGTATGCAAGACCGTGCCAGAGTACTATTTCACACCTCCAGAATCTGAGCAACCTGACCGGAGAGCAATCAACCAACCACCCGAAGATTGGCTTCCGATCACCCAATCAAGAAAAGGGAATTCATGGACGGCAACATTCCATTTGCTTTCGTCGGGAATCGGAGTTCAAACACTCTCTCTACC...

Protein

Download Protein FASTA

490 aa · TkA03G463490|TK1151|PROTEIN

MRFLRCKEGEIVLEKRIHIINNGDDIVCKTVPEYYFTPPESEQPDRRAINQPPEDWLPITQSRKGNSWTATFHLLSSGIGVQTLSLPFAFMYLGWFWGILCLSLAFVWQLYTILLLVDLHESISGTRYSRYLQLSVVAFGVKLGKVLAIFPLMYLSGGSCVMFIITGGGTLKLFYQLLCEDCSSKNPLTTSQWFLVFICLATLVSMFCPNLHSVALVSVLGAIMAVGYCTILWVLFINKERVNDLVHDPSKVTESKADRI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G463490`
TK1151 ID	TkA03G463490
OH-1004 ID	LXL04_009698
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.184 / OH-1004 98.580 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G463490

Location Chr03:115688968-115691758 (-)

Description Similar to At4g35180: Lysine histidine transporter-like 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35180`	Amino acid transporter.	No verified direct reference in this release
`At1g47670`	Amino acid transporter.	No verified direct reference in this release
`At5g40780`	Amino acid-proton symporter.	Arabidopsis LHT1 is a high-affinity transporter for cellular amino acid uptake in both root epidermis and leaf mesophyll.2006 · DOI: 10.1105/tpc.106.041012 Comprehensive screening of Arabidopsis mutants suggests the lysine histidine transporter 1 to be involved in plant uptake of amino acids.2007 · DOI: 10.1104/pp.106.092205 Root uptake of cationic amino acids by Arabidopsis depends on functional expression of amino acid permease 5.2008 · DOI: 10.1111/j.1469-8137.2008.02589.x LHT1, a lysine- and histidine-specific amino acid transporter in arabidopsis.1997 · DOI: 10.1104/pp.115.3.1127
`At1g48640`	Amino acid transporter.	No verified direct reference in this release
`At1g24400`	Amino acid-proton symporter.	Selective expression of a novel high-affinity transport system for acidic and neutral amino acids in the tapetum cells of Arabidopsis flowers.2004 · DOI: 10.1111/j.1365-313x.2004.02186.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009698 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006952 defense response Biological Process

GO:0043090 amino acid import Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015172 acidic amino acid transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G24400

ath:AT1G47670

ath:AT1G48640

ath:AT4G35180

ath:AT5G40780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.591

Rank 1 · TkA03G463490 · TK1151

Lysosome / Vacuole0.192

Rank 2 · TkA03G463490 · TK1151

Endoplasmic reticulum0.125

Rank 3 · TkA03G463490 · TK1151

Cytoplasm0.102

Rank 4 · TkA03G463490 · TK1151

Golgi apparatus0.061

Rank 5 · TkA03G463490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490Aa_trans64-475 aa

PF26873Phage_T4_Y06O135-159 aa

PF26243DUF8056189-222 aa

PF06979TMEM70217-251 aa

PF26873Phage_T4_Y06O269-331 aa

PF26243DUF8056283-358 aa

PF06979TMEM70356-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G463490	`PF01490`	Aa_trans	64	475	2.3e-48	165.6
TkA03G463490	`PF26873`	Phage_T4_Y06O	135	159	0.13	13.0
TkA03G463490	`PF26243`	DUF8056	189	222	0.75	10.1
TkA03G463490	`PF06979`	TMEM70	217	251	0.074	13.6
TkA03G463490	`PF26873`	Phage_T4_Y06O	269	331	0.13	13.0
TkA03G463490	`PF26243`	DUF8056	283	358	0.75	10.1
TkA03G463490	`PF06979`	TMEM70	356	416	0.074	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WE9`	Arabidopsis thaliana	sp\|Q84WE9\|LHTL7_ARATH Lysine histidine transporter-like 7	47.500%	Swiss-Prot	Medium
`Q9SX98`	Arabidopsis thaliana	sp\|Q9SX98\|LHTL8_ARATH Lysine histidine transporter-like 8	44.700%	Swiss-Prot	Medium
`Q9FKS8`	Arabidopsis thaliana	sp\|Q9FKS8\|LHT1_ARATH Lysine histidine transporter 1	33.700%	Swiss-Prot	Medium
`Q9C733`	Arabidopsis thaliana	sp\|Q9C733\|LHTL1_ARATH Lysine histidine transporter-like 1	33.100%	Swiss-Prot	Medium
`Q9LRB5`	Arabidopsis thaliana	sp\|Q9LRB5\|LHT2_ARATH Lysine histidine transporter 2	32.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card