TkA03G457990 | RubberDandelionOmics

Gene overview

TkA03G457990

Reference: TK1151 Chr: Chr03 Coordinates: 114332175-114332726 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · TkA03G457990|TK1151|cDNA

ATGGCCGTGATAGCTCTTAAGTGCCCTAATATAGAAGTGGCTGTTGTTGACATTTCTGTTCCTCGTATCACTGCGTGGAACAGCGACCAGCTTCCTATCTATGAGCCAGGGCTTGATGATGTGGTGAAGCAGTGCCGTGGCAAGAATCTATTTTTTAGCACAGATGTGGAGAAACATGTCTTTGAGGCTGACATTGTCTTTGTCTCTGTCAATACCCCTACCAAGACTCGGGGTCTTGGAGCTGGCAAAGCTGCCGATTT...

CDS

Download CDS FASTA

552 bp · TkA03G457990|TK1151|CDS

ATGGCCGTGATAGCTCTTAAGTGCCCTAATATAGAAGTGGCTGTTGTTGACATTTCTGTTCCTCGTATCACTGCGTGGAACAGCGACCAGCTTCCTATCTATGAGCCAGGGCTTGATGATGTGGTGAAGCAGTGCCGTGGCAAGAATCTATTTTTTAGCACAGATGTGGAGAAACATGTCTTTGAGGCTGACATTGTCTTTGTCTCTGTCAATACCCCTACCAAGACTCGGGGTCTTGGAGCTGGCAAAGCTGCCGATTT...

Protein

Download Protein FASTA

183 aa · TkA03G457990|TK1151|PROTEIN

MAVIALKCPNIEVAVVDISVPRITAWNSDQLPIYEPGLDDVVKQCRGKNLFFSTDVEKHVFEADIVFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGINFRFSLTRSSLQRGLQFKIFITRQVLIGGRETPEGNKAVQSIEVCLCPLGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G457990`
TK1151 ID	TkA03G457990
OH-1004 ID	LXL04_008689
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.400
Protein coverage (%)	TK1151 95.628 / OH-1004 33.652 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G457990

Location Chr03:114332175-114332726 (+)

Description Similar to UGD1: UDP-glucose 6-dehydrogenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g29360`	Involved in the biosynthesis of UDP-glucuronic acid (UDP- GlcA), providing nucleotide sugars for cell-wall polymers.	Down-regulation of UDP-glucuronic acid biosynthesis leads to swollen plant cell walls and severe developmental defects associated with changes in pectic polysaccharides.2011 · DOI: 10.1074/jbc.m111.255695 Cell wall ingrowths in nematode induced syncytia require UGD2 and UGD3.2012 · DOI: 10.1371/journal.pone.0041515
`At5g15490`	Involved in the biosynthesis of UDP-glucuronic acid (UDP- GlcA), providing nucleotide sugars for cell-wall polymers.	Down-regulation of UDP-glucuronic acid biosynthesis leads to swollen plant cell walls and severe developmental defects associated with changes in pectic polysaccharides.2011 · DOI: 10.1074/jbc.m111.255695 Cell wall ingrowths in nematode induced syncytia require UGD2 and UGD3.2012 · DOI: 10.1371/journal.pone.0041515
`At5g39320`	Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0443600`	Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008689 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006024 glycosaminoglycan biosynthetic process Biological Process

GO:0006065 UDP-glucuronate biosynthetic process Biological Process

GO:0052546 cell wall pectin metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0003979 UDP-glucose 6-dehydrogenase activity Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT5G15490

dosa:Os03g0757900

dosa:Os12g0443500

dosa:Os12g0443600

gmx:548074

osa:4352147

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.369

Rank 1 · TkA03G457990 · TK1151

Extracellular0.184

Rank 2 · TkA03G457990 · TK1151

Peroxisome0.164

Rank 3 · TkA03G457990 · TK1151

Nucleus0.139

Rank 4 · TkA03G457990 · TK1151

Mitochondrion0.105

Rank 5 · TkA03G457990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03721UDPG_MGDP_dh_N5-168 aa

PF01488Shikimate_DH11-22 aa

PF01488Shikimate_DH40-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G457990	`PF03721`	UDPG_MGDP_dh_N	5	168	1.6e-40	139.6
TkA03G457990	`PF01488`	Shikimate_DH	11	22	0.051	14.4
TkA03G457990	`PF01488`	Shikimate_DH	40	76	0.051	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIA8`	Arabidopsis thaliana	sp\|Q9LIA8\|UGDH2_ARATH UDP-glucose 6-dehydrogenase 2	83.000%	Swiss-Prot	High
`Q9LF33`	Arabidopsis thaliana	sp\|Q9LF33\|UGDH3_ARATH UDP-glucose 6-dehydrogenase 3	81.300%	Swiss-Prot	High
`Q9FM01`	Arabidopsis thaliana	sp\|Q9FM01\|UGDH4_ARATH UDP-glucose 6-dehydrogenase 4	81.800%	Swiss-Prot	High
`Q2QS13`	Oryza sativa subsp. japonica	sp\|Q2QS13\|UGDH5_ORYSJ UDP-glucose 6-dehydrogenase 5	80.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card