RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G440990
Reference: TK1151 Chr: Chr03 Coordinates: 109877936-109879837 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1872 bp · TkA03G440990|TK1151|cDNA

ATGACCACCACTCGCCACCTCTCTATCTTCTCTTTCTTCGCTCTCGTCCTATTGGTTAATGCCAGATTAAATCTAGAACCAACTGACCATGAAGCTCTCTTGGAAGTGTACAAGGATTTGGGTATCTCAAGTGGCACAGACAACATTTGTAACGCCGCCGGAGTATTCTGTGAGCGGAGGATCTCCAACAACTCGTATGTTCTCCGAGTAACCCGTATTGTCTTCAAGCCTCGCCGCCTGAGAGGCTCTATCTCTCCGGC...

CDS

Download CDS FASTA

1872 bp · TkA03G440990|TK1151|CDS

ATGACCACCACTCGCCACCTCTCTATCTTCTCTTTCTTCGCTCTCGTCCTATTGGTTAATGCCAGATTAAATCTAGAACCAACTGACCATGAAGCTCTCTTGGAAGTGTACAAGGATTTGGGTATCTCAAGTGGCACAGACAACATTTGTAACGCCGCCGGAGTATTCTGTGAGCGGAGGATCTCCAACAACTCGTATGTTCTCCGAGTAACCCGTATTGTCTTCAAGCCTCGCCGCCTGAGAGGCTCTATCTCTCCGGC...

Protein

Download Protein FASTA

623 aa · TkA03G440990|TK1151|PROTEIN

MTTTRHLSIFSFFALVLLVNARLNLEPTDHEALLEVYKDLGISSGTDNICNAAGVFCERRISNNSYVLRVTRIVFKPRRLRGSISPAIGKLSELKEFSLPNNHLVDQIPTQITDCRKLEVLDLHSNRLSGKVPVGLSSLVRLRVLDLSSNKFSGDLDFLKYFPNLEKLSLANNMFVGKVPASLRSFRNLRFFNISGNSFLEGPMPTLKQFESPSEELQNGNKNLVPKRYVFAESNTTSPAERNQTENRAPSPAAEPSRKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G440990
TK1151 IDTkA03G440990
OH-1004 IDLXL04_001342
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)75.700
Protein coverage (%)TK1151 50.241 / OH-1004 44.853
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G440990
LocationChr03:109877936-109879837 (-)
DescriptionSimilar to SOBIR1: Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g31880 Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.
Regulation of cell death and innate immunity by two receptor-like kinases in Arabidopsis.2009 · DOI: 10.1016/j.chom.2009.05.019
An RLP23-SOBIR1-BAK1 complex mediates NLP-triggered immunity.2015 · DOI: 10.1038/nplants.2015.140
At3g13380 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.
BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403
At1g08590 Involved in the regulation of procambium maintenance and polarity during vascular-tissue development. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os09g0293500 May be involved in brassenosteroid (BR) perception in roots.
The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330
Os01g0718300 Receptor kinase involved in brassinosteroid (BR) signal transduction.
Loss of function of a rice brassinosteroid insensitive1 homolog prevents internode elongation and bending of the lamina joint.2000 · DOI: 10.1105/tpc.12.9.1591
The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330
OsBRI1 Activates BR Signaling by Preventing Binding between the TPR and Kinase Domains of OsBSK3 via Phosphorylation.2016 · DOI: 10.1104/pp.15.01668
OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001342 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010038 response to metal ion Biological Process
GO:0010118 stomatal movement Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0030308 negative regulation of cell growth Biological Process
KEGG gene cross-reference
ath:AT2G31880
ath:AT3G51550
ath:AT5G39000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.865
Rank 1 · TkA03G440990 · TK1151
Endoplasmic reticulum0.086
Rank 2 · TkA03G440990 · TK1151
Cytoplasm0.080
Rank 3 · TkA03G440990 · TK1151
Nucleus0.052
Rank 4 · TkA03G440990 · TK1151
Lysosome / Vacuole0.023
Rank 5 · TkA03G440990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598LRR_1478-148 aa
PF12799LRR_483-108 aa
PF24758LRR_At5g5637087-192 aa
PF13855LRR_893-152 aa
PF25013LRR_Zer-193-126 aa
PF00560LRR_194-114 aa
PF20209DUF657094-118 aa
PF23211LRR_LRWD1109-220 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G440990PF23598LRR_14781482.1e-0834.1
TkA03G440990PF12799LRR_4831089.7e-1658.2
TkA03G440990PF24758LRR_At5g56370871920.0007719.9
TkA03G440990PF13855LRR_8931525.7e-1452.3
TkA03G440990PF25013LRR_Zer-1931260.008916.9
TkA03G440990PF00560LRR_1941141.9e-1348.4
TkA03G440990PF20209DUF6570941180.1912.9
TkA03G440990PF23211LRR_LRWD11092207.9e-0626.4
TkA03G440990PF13516LRR_61151300.1213.2
TkA03G440990PF12799LRR_41171609.7e-1658.2
TkA03G440990PF00560LRR_11171391.9e-1348.4
TkA03G440990PF07723LRR_21171301.010.9
TkA03G440990PF25013LRR_Zer-11361980.008916.9
TkA03G440990PF23598LRR_141372112.1e-0834.1
TkA03G440990PF00560LRR_11411551.9e-1348.4
TkA03G440990PF13516LRR_61421540.1213.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SKB2Arabidopsis thalianasp|Q9SKB2|SBIR1_ARATH Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR164.500%Swiss-ProtHigh
Q9LJF3Arabidopsis thalianasp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 338.400%Swiss-ProtMedium
Q9FRS6Arabidopsis thalianasp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL140.300%Swiss-ProtLow
Q69JN6Oryza sativa subsp. japonicasp|Q69JN6|BRL1_ORYSJ Brassinosteroid LRR receptor kinase BRL137.500%Swiss-ProtMedium
Q942F3Oryza sativa subsp. japonicasp|Q942F3|BRI1_ORYSJ Brassinosteroid LRR receptor kinase BRI138.600%Swiss-ProtMedium

JBrowse

View in Genome Browser